ATOH8 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of human ATOH8. Peptide sequence: LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ATOH8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ATOH8 Antibody - BSA Free
Background
Putative transcription factor. May be implicated in specification and differentiation of neuronal celllineages in the brain. May participate in kidney development and may be involved in podocyte differentiation (Bysimilarity)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: IHC
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ChIP, ICC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: WB
Publications for ATOH8 Antibody (NBP2-84479) (0)
There are no publications for ATOH8 Antibody (NBP2-84479).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ATOH8 Antibody (NBP2-84479) (0)
There are no reviews for ATOH8 Antibody (NBP2-84479).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ATOH8 Antibody (NBP2-84479) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ATOH8 Products
Research Areas for ATOH8 Antibody (NBP2-84479)
Find related products by research area.
|
Blogs on ATOH8