ATOH8 Antibody - BSA Free

Western Blot: ATOH8 Antibody [NBP2-84479] - WB Suggested Anti-ATOH8 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: COLO205 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATOH8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ATOH8 Antibody - BSA Free (NBP2-84479) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human ATOH8. Peptide sequence: LRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATOH8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATOH8 Antibody - BSA Free

• ATH6
• atonal homolog 6
• atonal homolog 8 (Drosophila)
• basic helix-loop-helix transcription factor 6
• BHLHA21
• bHLHa21basic helix loop helix transcription factor 6
• Class A basic helix-loop-helix protein 21
• FLJ14708
• FLJ38730
• HATH6
• Helix-loop-helix protein hATH-6
• protein atonal homolog 8

Background

Putative transcription factor. May be implicated in specification and differentiation of neuronal celllineages in the brain. May participate in kidney development and may be involved in podocyte differentiation (Bysimilarity)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATOH8