Atlastin-2 Antibody

Images

 
Western Blot: Atlastin-2 Antibody [NBP1-98394] - Mouse Pancreas Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Atlastin-2 Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
The immunogen for this antibody is Atlastin-2 - C-terminal region. Peptide sequence KQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFYAARTPA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-98394 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Atlastin-2 Antibody

  • ADP-ribosylation factor-like 6 interacting protein 2
  • ADP-ribosylation factor-like protein 6-interacting protein 2
  • ADP-ribosylation-like factor 6 interacting protein 2
  • aip-2
  • ARL3IP2
  • ARL-6-interacting protein 2
  • ARL6IP2
  • atlastin GTPase 2
  • atlastin2
  • atlastin-2
  • EC 3.6.5.-
  • FLJ23293

Background

GTPase tethering membranes through formation of trans-homooligomer and mediating homotypic fusion ofendoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Atlastin-2 Antibody (NBP1-98394)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Atlastin-2 Antibody (NBP1-98394) (0)

There are no reviews for Atlastin-2 Antibody (NBP1-98394). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Atlastin-2 Antibody (NBP1-98394) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Atlastin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATL2
Uniprot