Atlastin-2 Antibody


Western Blot: Atlastin-2 Antibody [NBP1-59016] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Atlastin-2 Antibody Summary

Synthetic peptides corresponding to ARL6IP2(ADP-ribosylation factor-like 6 interacting protein 2) The peptide sequence was selected from the C terminal of ARL6IP2. Peptide sequence MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARL6IP2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Atlastin-2 Antibody

  • ADP-ribosylation factor-like 6 interacting protein 2
  • ADP-ribosylation factor-like protein 6-interacting protein 2
  • ADP-ribosylation-like factor 6 interacting protein 2
  • aip-2
  • ARL3IP2
  • ARL-6-interacting protein 2
  • ARL6IP2
  • atlastin GTPase 2
  • atlastin2
  • atlastin-2
  • EC 3.6.5.-
  • FLJ23293


ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
Species: Hu
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA, ICC
Species: Hu
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF

Publications for Atlastin-2 Antibody (NBP1-59016) (0)

There are no publications for Atlastin-2 Antibody (NBP1-59016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Atlastin-2 Antibody (NBP1-59016) (0)

There are no reviews for Atlastin-2 Antibody (NBP1-59016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Atlastin-2 Antibody (NBP1-59016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Atlastin-2 Products

Bioinformatics Tool for Atlastin-2 Antibody (NBP1-59016)

Discover related pathways, diseases and genes to Atlastin-2 Antibody (NBP1-59016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Atlastin-2 Antibody (NBP1-59016)

Discover more about diseases related to Atlastin-2 Antibody (NBP1-59016).

Pathways for Atlastin-2 Antibody (NBP1-59016)

View related products by pathway.

PTMs for Atlastin-2 Antibody (NBP1-59016)

Learn more about PTMs related to Atlastin-2 Antibody (NBP1-59016).

Blogs on Atlastin-2

There are no specific blogs for Atlastin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Atlastin-2 Antibody and receive a gift card or discount.


Gene Symbol ATL2