Atlastin-2 Antibody

Images

 
Western Blot: Atlastin-2 Antibody [NBP1-59016] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Atlastin-2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARL6IP2(ADP-ribosylation factor-like 6 interacting protein 2) The peptide sequence was selected from the C terminal of ARL6IP2. Peptide sequence MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ARL6IP2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Atlastin-2 Antibody

  • ADP-ribosylation factor-like 6 interacting protein 2
  • ADP-ribosylation factor-like protein 6-interacting protein 2
  • ADP-ribosylation-like factor 6 interacting protein 2
  • aip-2
  • ARL3IP2
  • ARL-6-interacting protein 2
  • ARL6IP2
  • atlastin GTPase 2
  • atlastin2
  • atlastin-2
  • EC 3.6.5.-
  • FLJ23293

Background

ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-90202
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49637
Species: Hu
Applications: WB, IHC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF

Publications for Atlastin-2 Antibody (NBP1-59016) (0)

There are no publications for Atlastin-2 Antibody (NBP1-59016).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Atlastin-2 Antibody (NBP1-59016) (0)

There are no reviews for Atlastin-2 Antibody (NBP1-59016). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Atlastin-2 Antibody (NBP1-59016) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Atlastin-2 Products

Bioinformatics Tool for Atlastin-2 Antibody (NBP1-59016)

Discover related pathways, diseases and genes to Atlastin-2 Antibody (NBP1-59016). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Atlastin-2 Antibody (NBP1-59016)

Discover more about diseases related to Atlastin-2 Antibody (NBP1-59016).
 

Pathways for Atlastin-2 Antibody (NBP1-59016)

View related products by pathway.

PTMs for Atlastin-2 Antibody (NBP1-59016)

Learn more about PTMs related to Atlastin-2 Antibody (NBP1-59016).

Blogs on Atlastin-2

There are no specific blogs for Atlastin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Atlastin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATL2
Uniprot