ATIC Antibody

Images

 
Western Blot: ATIC Antibody [H00000471-B01P] - Analysis of ATIC expression in human liver.
Western Blot: ATIC Antibody [H00000471-B01P] - Analysis of ATIC expression in transfected 293T cell line by ATIC polyclonal antibody. Lane 1: ATIC transfected lysate(65.12 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATIC Antibody Summary

Immunogen
ATIC (NP_004035.2, 1 a.a. - 592 a.a.) full-length human protein. MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ATIC
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATIC Antibody

  • 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMPcyclohydrolase
  • 5-aminoimidazole-4-carboxamide-1-beta-D-ribonucleotidetransformylase/inosinicase
  • AICAR formyltransferase/IMP cyclohydrolase bifunctional enzyme
  • AICAR
  • AICARFT
  • AICARFT/IMPCHASE
  • bifunctional purine biosynthesis protein PURH
  • IMPCHASE
  • phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
  • PURHFLJ93545

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00597
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P

Publications for ATIC Antibody (H00000471-B01P) (0)

There are no publications for ATIC Antibody (H00000471-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATIC Antibody (H00000471-B01P) (0)

There are no reviews for ATIC Antibody (H00000471-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATIC Antibody (H00000471-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATIC Products

Bioinformatics Tool for ATIC Antibody (H00000471-B01P)

Discover related pathways, diseases and genes to ATIC Antibody (H00000471-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATIC Antibody (H00000471-B01P)

Discover more about diseases related to ATIC Antibody (H00000471-B01P).
 

Pathways for ATIC Antibody (H00000471-B01P)

View related products by pathway.

PTMs for ATIC Antibody (H00000471-B01P)

Learn more about PTMs related to ATIC Antibody (H00000471-B01P).
 

Research Areas for ATIC Antibody (H00000471-B01P)

Find related products by research area.

Blogs on ATIC

There are no specific blogs for ATIC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATIC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATIC
Uniprot