Recombinant Human ATG16L1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ATG16L1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-523 of Human ATG16L1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY

Protein/Peptide Type
Recombinant Protein
Gene
ATG16L1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00055054-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATG16L1 Protein

  • APG16 autophagy 16-like (S. cerevisiae)
  • APG16L beta
  • APG16LFLJ10828
  • APG16-like 1
  • ATG16 autophagy related 16-like (S. cerevisiae)
  • ATG16 autophagy related 16-like 1 (S. cerevisiae)
  • ATG16A
  • ATG16L
  • autophagy-related protein 16-1
  • FLJ00045
  • FLJ10035
  • FLJ22677
  • IBD10
  • WD repeat domain 30
  • WDR30

Background

Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NBP1-76377
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-15501
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57222
Species: Hu
Applications: ICC/IF
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
MAB7442
Species: Hu
Applications: WB, B/N
NBP2-47559
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13659
Species: Hu
Applications: IHC, IHC-P
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
H00055054-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ATG16L1 Recombinant Protein (H00055054-P01)(1)


Reviews for ATG16L1 Recombinant Protein (H00055054-P01) (0)

There are no reviews for ATG16L1 Recombinant Protein (H00055054-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATG16L1 Recombinant Protein (H00055054-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATG16L1 Products

Bioinformatics Tool for ATG16L1 Recombinant Protein (H00055054-P01)

Discover related pathways, diseases and genes to ATG16L1 Recombinant Protein (H00055054-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG16L1 Recombinant Protein (H00055054-P01)

Discover more about diseases related to ATG16L1 Recombinant Protein (H00055054-P01).
 

Pathways for ATG16L1 Recombinant Protein (H00055054-P01)

View related products by pathway.

PTMs for ATG16L1 Recombinant Protein (H00055054-P01)

Learn more about PTMs related to ATG16L1 Recombinant Protein (H00055054-P01).
 

Research Areas for ATG16L1 Recombinant Protein (H00055054-P01)

Find related products by research area.

Blogs on ATG16L1.

ATG16L1 - a key player in the development of the autophagosome
Untitled DocumentLike apoptosis, autophagy is a highly regulated physiologic process that involves cellular degradation and recycling of organelles and macromolecules. Autophagy is a survival mechanism induced by states of stress, s...  Read full blog post.

Customers Who Bought This Also Bought

ATG16L1 Antibody
NB110-60928
LC3A Antibody
NB100-2331

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATG16L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG16L1