We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human ATF4 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ATF4 Peptides and Proteins

Order Details


    • Catalog Number
      H00000468-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ATF4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-351 fo Human ATF4.

Source:Wheat Germ

Amino Acid Sequence: MTEMSFLSSEVLVGDLMSPFDPSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPPPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATF4

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Publications
Read Publication using H00000468-P01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATF4 Protein

  • activating transcription factor 4 (tax-responsive enhancer element B67)
  • Activating transcription factor 4
  • ATF4
  • cAMP-dependent transcription factor ATF-4
  • cAMP-responsive element-binding protein 2
  • CREB-2DNA-binding protein TAXREB67
  • cyclic AMP-dependent transcription factor ATF-4
  • Cyclic AMP-responsive element-binding protein 2
  • TAXREB67
  • TAXREB67CREB2cAMP response element-binding protein 2
  • Tax-responsive enhancer element-binding protein 67
  • TXREB

Background

ATF4( AAH08090, 1 a.a. - 352 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP1-90364
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF3999
Species: Hu
Applications: KO, WB
NBP1-40256
Species: Hu, Mu, Pl, Po, Rb, Rt
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
212-GD
Species: Hu
Applications: Bind, BA
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
1310-SE
Species: Hu
Applications: EnzAct
NBP1-85816
Species: Hu, Mu
Applications: ICC/IF,  IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP3-16112
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-778
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2323
Species: Dr, Gt, SyHa, Hu, Ma, Pm, Mu, Po, Pm, Rb, Rt
Applications: ChIP, ELISA, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, Simple Western, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB100-56398
Species: Hu
Applications: ICC/IF, WB
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for ATF4 Partial Recombinant Protein (H00000468-P01)(1)

Reviews for ATF4 Partial Recombinant Protein (H00000468-P01) (0)

There are no reviews for ATF4 Partial Recombinant Protein (H00000468-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATF4 Partial Recombinant Protein (H00000468-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATF4 Products

Research Areas for ATF4 Partial Recombinant Protein (H00000468-P01)

Find related products by research area.

Blogs on ATF4.

The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.

eIF2alpha - a regulator of global translation in response to cellular stress
Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni...  Read full blog post.

CENPF Antibodies as Potential Cancer Markers
Centromere protein F (CENPF), also named mitosin, is a large human protein of 3113 amino acid residues. Its expression and localization are cell cycle-dependent. The protein levels are low in G1 phase but elevated from S to early M phase. CENPF is a n...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ATF4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF4