Recombinant Human ATF4 Protein

Product Discontinued

Recombinant Human ATF4 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-351 fo Human ATF4.
  
  

  Source:Wheat Germ

  Amino Acid Sequence: MTEMSFLSSEVLVGDLMSPFDPSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPPPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: ATF4

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ATF4 Protein

• activating transcription factor 4 (tax-responsive enhancer element B67)
• Activating transcription factor 4
• ATF4
• cAMP-dependent transcription factor ATF-4
• cAMP-responsive element-binding protein 2
• CREB-2DNA-binding protein TAXREB67
• cyclic AMP-dependent transcription factor ATF-4
• Cyclic AMP-responsive element-binding protein 2
• TAXREB67
• TAXREB67CREB2cAMP response element-binding protein 2
• Tax-responsive enhancer element-binding protein 67
• TXREB

Background

ATF4( AAH08090, 1 a.a. - 352 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for ATF4 Partial Recombinant Protein (H00000468-P01)(1)

Publication using H00000468-P01

• Zhang N, Khachigian LM. Injury-induced platelet-derived growth factor receptor-alpha expression mediated by interleukin-1beta (IL-1beta) release and cooperative transactivation by NF-kappaB and ATF-4: IL-1beta facilitates HDAC-1/2 dissociation from promoter. J Biol Chem. 2009-10-09 [PMID: 19648113]

Bioinformatics

• Gene Symbol: ATF4