Ataxin-2 Antibody

Images

 
There are currently no images for Ataxin-2 Antibody (H00006311-A01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Ataxin-2 Antibody Summary

Immunogen
ATXN2 (NP_002964 1214 a.a. - 1313 a.a.) partial recombinant protein with GST tag. PQNSFPAAQQTVFTIHPSHVQPAYTNPPHMAHVPQAHVQSGMVPSHPTAHAPMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL
Specificity
ATXN2 - ataxin 2
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ATXN2
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ataxin-2 Antibody

  • ataxin 2
  • ataxin 2)
  • ataxin-2
  • ATX2spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant
  • SCA2FLJ46772
  • Spinocerebellar ataxia type 2 protein
  • TNRC13
  • trinucleotide repeat containing 13
  • Trinucleotide repeat-containing gene 13 protein

Background

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. Defects in this gene are the cause of spinocerebellar ataxia type 2 (SCA2). SCA2 belongs to the autosomal dominant cerebellar ataxias type I (ADCA I) which are characterized by cerebellar ataxia in combination with additional clinical features like optic atrophy, ophthalmoplegia, bulbar and extrapyramidal signs, peripheral neuropathy and dementia. SCA2 is caused by expansion of a CAG repeat in the coding region of this gene. Longer expansions result in earlier onset of the disease. Alternatively spliced transcript variants encoding different isoforms have been identified but their full length sequence has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF1436
Species: Mu
Applications: WB
NBP2-13169
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-56984
Species: Hu
Applications: ICC/IF
NBP2-49081
Species: Hu
Applications: WB, IHC
NB110-58346
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-78989
Species: Mu, Rt
Applications: WB (-), IHC

Publications for Ataxin-2 Antibody (H00006311-A01) (0)

There are no publications for Ataxin-2 Antibody (H00006311-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin-2 Antibody (H00006311-A01) (0)

There are no reviews for Ataxin-2 Antibody (H00006311-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ataxin-2 Antibody (H00006311-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ataxin-2 Products

Bioinformatics Tool for Ataxin-2 Antibody (H00006311-A01)

Discover related pathways, diseases and genes to Ataxin-2 Antibody (H00006311-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin-2 Antibody (H00006311-A01)

Discover more about diseases related to Ataxin-2 Antibody (H00006311-A01).
 

Pathways for Ataxin-2 Antibody (H00006311-A01)

View related products by pathway.

PTMs for Ataxin-2 Antibody (H00006311-A01)

Learn more about PTMs related to Ataxin-2 Antibody (H00006311-A01).
 

Research Areas for Ataxin-2 Antibody (H00006311-A01)

Find related products by research area.

Blogs on Ataxin-2

There are no specific blogs for Ataxin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ataxin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATXN2
Entrez
OMIM
Uniprot