Recombinant Human Ataxin-10 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Ataxin-10 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-109 of Human Ataxin-10

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAPRPPPARLSGVMVPAPIQDLEALRALTALFKEQRNRETAPRTIFQRVLDILKKSSHAVELACRDPSQVENLASSLQLITECFRCLRNACIECSVNQNSIRNLDTIG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ATXN10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ataxin-10 GST (N-Term) Protein

  • ataxin 10
  • ataxin-10
  • Brain protein E46 homolog
  • E46L
  • FLJ37990
  • HUMEEP
  • SCA10spinocerebellar ataxia 10
  • Spinocerebellar ataxia type 10 protein

Background

ATXN10 - ataxin 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92853
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP1-90063
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-17155
Species: Hu
Applications: IHC, IHC-P
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32535
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-86562
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-04588
Species: Hu, Mu, Rt
Applications: WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-54439
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-32791
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00003748-M01
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
NBP1-21398
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for Ataxin-10 Partial Recombinant Protein (H00025814-Q01) (0)

There are no publications for Ataxin-10 Partial Recombinant Protein (H00025814-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ataxin-10 Partial Recombinant Protein (H00025814-Q01) (0)

There are no reviews for Ataxin-10 Partial Recombinant Protein (H00025814-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ataxin-10 Partial Recombinant Protein (H00025814-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ataxin-10 Products

Bioinformatics Tool for Ataxin-10 Partial Recombinant Protein (H00025814-Q01)

Discover related pathways, diseases and genes to Ataxin-10 Partial Recombinant Protein (H00025814-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ataxin-10 Partial Recombinant Protein (H00025814-Q01)

Discover more about diseases related to Ataxin-10 Partial Recombinant Protein (H00025814-Q01).
 

Pathways for Ataxin-10 Partial Recombinant Protein (H00025814-Q01)

View related products by pathway.

PTMs for Ataxin-10 Partial Recombinant Protein (H00025814-Q01)

Learn more about PTMs related to Ataxin-10 Partial Recombinant Protein (H00025814-Q01).

Blogs on Ataxin-10

There are no specific blogs for Ataxin-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ataxin-10 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ATXN10