Aspartyl Aminopeptidase Antibody

Images

 
Western Blot: Aspartyl Aminopeptidase Antibody [H00023549-B01P] - Analysis of DNPEP expression in transfected 293T cell line by DNPEP polyclonal antibody. Lane 1: DNPEP transfected lysate(18.04 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Aspartyl Aminopeptidase Antibody Summary

Immunogen
DNPEP (AAH03040.1, 1 a.a. - 164 a.a.) full-length human protein. MTRNSSTIIAFAVGGQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGRVIVKCPTSGRLEQQLVHVERPILRIPHLAIHLQRNINENFGPNTEMHLVPILATAIQEELEKGTPEPGLSMLWMSGTIRSSCPCSVPIWG
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
DNPEP
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aspartyl Aminopeptidase Antibody

  • aspartyl aminopeptidase
  • ASPEPDAPEC 3.4.11.21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2558
Species: Hu, Mu
Applications: Simple Western, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NBP2-80573
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IHC-P, IP
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NBP1-89519
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NBP2-66825
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB

Publications for Aspartyl Aminopeptidase Antibody (H00023549-B01P) (0)

There are no publications for Aspartyl Aminopeptidase Antibody (H00023549-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aspartyl Aminopeptidase Antibody (H00023549-B01P) (0)

There are no reviews for Aspartyl Aminopeptidase Antibody (H00023549-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aspartyl Aminopeptidase Antibody (H00023549-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aspartyl Aminopeptidase Products

Bioinformatics Tool for Aspartyl Aminopeptidase Antibody (H00023549-B01P)

Discover related pathways, diseases and genes to Aspartyl Aminopeptidase Antibody (H00023549-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aspartyl Aminopeptidase Antibody (H00023549-B01P)

Discover more about diseases related to Aspartyl Aminopeptidase Antibody (H00023549-B01P).
 

Pathways for Aspartyl Aminopeptidase Antibody (H00023549-B01P)

View related products by pathway.

Research Areas for Aspartyl Aminopeptidase Antibody (H00023549-B01P)

Find related products by research area.

Blogs on Aspartyl Aminopeptidase

There are no specific blogs for Aspartyl Aminopeptidase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aspartyl Aminopeptidase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNPEP