Asparagine synthetase Antibody (2B3)

Images

 
Immunoprecipitation: Asparagine synthetase Antibody (2B3) [H00000440-M02] - Analysis of ASNS transfected lysate using anti-ASNS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ASNS MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IP
Clone
2B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Asparagine synthetase Antibody (2B3) Summary

Immunogen
ASNS (AAH14621, 281 a.a. - 380 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKA
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ASNS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Asparagine synthetase Antibody (2B3)

  • asparagine synthetase (glutamine-hydrolyzing)
  • asparagine synthetase [glutamine-hydrolyzing]
  • asparagine synthetase
  • Cell cycle control protein TS11
  • EC 6.3.5.4
  • Glutamine-dependent asparagine synthetase
  • TS11 cell cycle control protein
  • TS11

Background

Asparagine synthetase (AS) is a housekeeping enzyme responsible for the production of asparagine from aspartate and glutamine. Most mammalian cells express AS and regulate the level of activity in response to the concentration of asparagine in the medium. Certain tumor cells in contrast, exhibit little or no AS activity and rely on the surrounding medium as a source of exogenous asparagines (1). Therefore tumor cells may be selectively killed by a chemotherapeutic drug using asparaginase. This approach has been exploited in the treatment of certain cancers like childhood acute lymphoblastic leukemia (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55125
Species: Hu
Applications: WB, ICC/IF
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56398
Species: Hu
Applications: WB, ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Asparagine synthetase Antibody (H00000440-M02) (0)

There are no publications for Asparagine synthetase Antibody (H00000440-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Asparagine synthetase Antibody (H00000440-M02) (0)

There are no reviews for Asparagine synthetase Antibody (H00000440-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Asparagine synthetase Antibody (H00000440-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Asparagine synthetase Products

Bioinformatics Tool for Asparagine synthetase Antibody (H00000440-M02)

Discover related pathways, diseases and genes to Asparagine synthetase Antibody (H00000440-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Asparagine synthetase Antibody (H00000440-M02)

Discover more about diseases related to Asparagine synthetase Antibody (H00000440-M02).
 

Pathways for Asparagine synthetase Antibody (H00000440-M02)

View related products by pathway.

PTMs for Asparagine synthetase Antibody (H00000440-M02)

Learn more about PTMs related to Asparagine synthetase Antibody (H00000440-M02).

Blogs on Asparagine synthetase

There are no specific blogs for Asparagine synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Asparagine synthetase Antibody (2B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol ASNS
Uniprot