ASH2L Antibody

Images

 
Western Blot: ASH2L Antibody [NBP1-88858] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: ASH2L Antibody [NBP1-88858] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ASH2L Antibody [NBP1-88858] - Staining of human tonsil shows nuclear positivity in non-germinal center.
Western Blot: ASH2L Antibody [NBP1-88858] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASH2L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASH2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASH2L Protein (NBP1-88858PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASH2L Antibody

  • ash2 (absent, small, or homeotic)-like (Drosophila)
  • ASH2
  • ASH2L1ash2 (absent, small, or homeotic, Drosophila, homolog)-like
  • ASH2L2ASH2-like protein
  • Bre2
  • set1/Ash2 histone methyltransferase complex subunit ASH2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB600-252
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF5810
Species: Hu, Mu
Applications: WB, IHC
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP
NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NB100-93290
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56630
Species: Hu
Applications: WB
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-91848
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7637
Species: Hu
Applications: WB
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2567
Species: Mu
Applications: WB, IHC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for ASH2L Antibody (NBP1-88858) (0)

There are no publications for ASH2L Antibody (NBP1-88858).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASH2L Antibody (NBP1-88858) (0)

There are no reviews for ASH2L Antibody (NBP1-88858). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASH2L Antibody (NBP1-88858) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASH2L Products

Bioinformatics Tool for ASH2L Antibody (NBP1-88858)

Discover related pathways, diseases and genes to ASH2L Antibody (NBP1-88858). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASH2L Antibody (NBP1-88858)

Discover more about diseases related to ASH2L Antibody (NBP1-88858).
 

Pathways for ASH2L Antibody (NBP1-88858)

View related products by pathway.

PTMs for ASH2L Antibody (NBP1-88858)

Learn more about PTMs related to ASH2L Antibody (NBP1-88858).

Blogs on ASH2L

There are no specific blogs for ASH2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASH2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASH2L