ASH2L Antibody (10B6U5)

Western Blot: ASH2L Antibody (10B6U5) [NBP3-16505] - Analysis of extracts of various cell lines, using ASH2L Rabbit mAb (NBP3-16505) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded human cervix cancer tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ASH2L Antibody (10B6U5) [NBP3-16505] - Confocal imaging of C2C12 cells using ASH2L Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded mouse brain tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded rat brain tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ASH2L Antibody (10B6U5) [NBP3-16505] - Confocal imaging of NIH/3T3 cells using ASH2L Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded human colon carcinoma tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded mouse lung tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: ASH2L Antibody (10B6U5) [NBP3-16505] - Confocal imaging of paraffin-embedded Mouse colon tissue using ASH2L Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clone: 10B6U5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ASH2L Antibody (10B6U5) Summary

• Description: Novus Biologicals Rabbit ASH2L Antibody (10B6U5) (NBP3-16505) is a recombinant monoclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 529-628 of human ASH2L (Q9UBL3). AEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ASH2L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ASH2L Antibody (10B6U5)

• ash2 (absent, small, or homeotic)-like (Drosophila)
• ASH2
• ASH2L1ash2 (absent, small, or homeotic, Drosophila, homolog)-like
• ASH2L2ASH2-like protein
• Bre2
• set1/Ash2 histone methyltransferase complex subunit ASH2

Background

ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. May function as a transcriptional regulator. May play a rol

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASH2L