ASCC3 Recombinant Protein Antigen

Images

 
There are currently no images for ASCC3 Protein (NBP1-88853PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ASCC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASCC3.

Source: E.coli

Amino Acid Sequence: QLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASCC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88853.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ASCC3 Recombinant Protein Antigen

  • activating signal cointegrator 1 complex subunit 3
  • B630009I04Rik
  • HELIC1
  • helicase, ATP binding 1
  • p200
  • RNA helicase family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01264
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-88815
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027044-Q01
Species: Hu
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-64843
Species: Mu
Applications: Flow, IHC, IHC-Fr, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC, IF
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB100-68205
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP

Publications for ASCC3 Protein (NBP1-88853PEP) (0)

There are no publications for ASCC3 Protein (NBP1-88853PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCC3 Protein (NBP1-88853PEP) (0)

There are no reviews for ASCC3 Protein (NBP1-88853PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ASCC3 Protein (NBP1-88853PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ASCC3 Protein (NBP1-88853PEP)

Discover related pathways, diseases and genes to ASCC3 Protein (NBP1-88853PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCC3 Protein (NBP1-88853PEP)

Discover more about diseases related to ASCC3 Protein (NBP1-88853PEP).
 

Pathways for ASCC3 Protein (NBP1-88853PEP)

View related products by pathway.

PTMs for ASCC3 Protein (NBP1-88853PEP)

Learn more about PTMs related to ASCC3 Protein (NBP1-88853PEP).

Blogs on ASCC3

There are no specific blogs for ASCC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TPX2 Antibody
NB500-179
ASCC3 Antibody
NBP1-88829

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASCC3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASCC3