Home » ASAP1 » ASAP1 Proteins » ASAP1 Recombinant Protein Antigen

ASAP1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ASAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASAP1.

Source: E. coli

Amino Acid Sequence: PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDC
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48909.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ASAP1 Recombinant Protein Antigen

  • 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activatingprotein
  • AMAP1
  • ARF GTPase-activating protein 1
  • arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
  • ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  • centaurin, beta 4
  • CENTB4
  • DDEF1ADP-ribosylation factor-directed GTPase-activating protein 1
  • development and differentiation enhancing factor 1
  • Development and differentiation-enhancing factor 1
  • Differentiation-enhancing factor 1
  • KIAA1249DEF-1
  • PAG2
  • PAP
  • PIP2-dependent ARF1 GAP
  • ZG14P

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: WB, ELISA, IHC

Puromycin-sensitive am ...
6410-ZN
Puromycin-sensitive aminopeptidase/NPEPPS
(1 Publication)
Species: Hu
PSAT1 Antibody
NBP1-32920
Western Blot: PSAT1 Antibody [NBP1-32920] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with PSAT1 antibody [N1C3].
Immunocytochemistry/Immunofluorescence: PSAT1 Antibody [NBP1-32920] - Paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: PSAT1 Antibody [NBP1-32920] - Paraffin-embedded NCI-N87 xenograft, using antibody at 1:500 dilution.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western blot shows human plasma. PVDF membrane was probed with 0.2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Specific bands were detected for Protein S/PROS1 at approximately 80 & 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows human plasma, loaded at 0.2 mg/mL. A specific band was detected for Protein S/PROS1 at approximately 106 kDa (as indicated) using 2 µg/mL of Goat Anti-Human Protein S/PROS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4036) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Publications)
Species: Hu
Applications: WB, Simple Western
PLAG1 Antibody
(3B7)
H00005324-M02
Western Blot: PLAG1 Antibody (3B7) [H00005324-M02] - Western Blot detection against Immunogen (36.52 KDa).
ELISA: PLAG1 Antibody (3B7) [H00005324-M02] - Detection limit for recombinant GST tagged PLAG1 is approximately 0.03ng/ml as a capture antibody.
(6 Publications)
Species: Hu
Applications: WB, ELISA, IHC
PDXP Antibody
NBP2-27461
Western Blot: PDXP Antibody [NBP2-27461] - 0.1 ug/ml staining of Mouse (A) and Rat (B) Brain lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: PDXP Antibody [NBP2-27461] - 5ug/ml staining of paraffin embedded Human Tonsil. Steamed antigen retrieval with citrate buffer Ph 6, AP-staining.
Western Blot: PDXP Antibody [NBP2-27461] - NBP2-27461 (0.1ug/ml) staining of Human Heart lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
CD155/PVR Antibody
(300907) [Unconjugate ...
MAB25301
U937 human histiocytic lymphoma cell line was stained with Mouse Anti-Human CD155/PVR Monoclonal Antibody (Catalog # MAB25301, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
HUVEC human umbilical vein endothelial cells were stained with Mouse Anti-Human CD155/PVR Monoclonal Antibody (Catalog # MAB25301, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
CD155/PVR was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Mouse Anti-Human CD155/PVR Monoclonal Antibody (Catalog # MAB25301) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
PMEL17/SILV
Antibody (OTI10E5)
NBP1-47974
Western Blot: PMEL17/SILV Antibody (10E5) [NBP1-47974] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PMEL17/SILV(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PMEL17/SILV.
Immunocytochemistry/Immunofluorescence: PMEL17/SILV Antibody (10E5) [NBP1-47974] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PMEL17/SILV.
Immunohistochemistry-Paraffin: PMEL17/SILV Antibody (10E5) [NBP1-47974] - Staining of paraffin-embedded prostate tissue using anti-PMEL17/SILV mouse monoclonal antibody.
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NDUFB6 Antibody
NBP1-92172
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
PRH2 Protein
H00005555-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
p19ARF Antibody
NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.
(1 Review)
(40 Publications)
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Western Blot: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
Immunohistochemistry-Paraffin: Coagulation Factor II/Thrombin Antibody [NBP1-58268] - Human Placenta Tissue
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
ATAT1 Antibody
NBP2-48990
Immunocytochemistry/Immunofluorescence: ATAT1 Antibody [NBP2-48990] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry: ATAT1 Antibody [NBP2-48990] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TAT Antibody
46420002
ELISA: TAT Antibody [46420002]
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ELISA
PAPD1 Antibody
(3D2)
NBP2-43679
Western Blot: PAPD1 Antibody (3D2) [NBP2-43679] - Analysis of 30 ug whole cell lysate. A: A549 B: H1299 C: HCT116 D: MCF-7 7.5% SDS PAGE diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PAPD1 Antibody (3D2) [NBP2-43679] - Analysis of methanol-fixed HeLa, using mtPAP antibody at 1:100 dilution.
Immunohistochemistry-Paraffin: PAPD1 Antibody (3D2) [NBP2-43679] - Analysis of Hepatoma, using mtPAP antibody at 1:200 dilution.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Serpin E1/PAI-1
Antibody
NBP1-19773
Western Blot: Serpin E1/PAI-1 Antibody [NBP1-19773] - Extracts from Jurkat cells.
Immunocytochemistry/Immunofluorescence: Serpin E1/PAI-1 Antibody [NBP1-19773] - PAI1/Serpine1 antibody was tested in Hela cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: Serpin E1/PAI-1 Antibody [NBP1-19773] - Staining of PAI1/Serpine 1 in mouse pancreas.
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
CEACAM5/CD66e
Antibody (487609) [Un ...
MAB41281
HEK293 human embryonic kidney cell line transfected with either (A) human CEACAM-5/CD66e or (B) humanCEACAM-8/CD66b and eGFP was stained with Mouse Anti-Human CEACAM‑5/CD66e Monoclonal Antibody (Catalog # MAB41281) followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). Quadrant markers were set based on control antibody staining (Catalog # MAB003).
CEACAM‑5/CD66e was detected in immersion fixed paraffin-embedded sections of human colon using Mouse Anti-Human CEACAM‑5/CD66e Monoclonal Antibody (Catalog # MAB41281) at 10 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell membranes. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(2 Reviews)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
CEACAM7 Antibody
[Unconjugated]
AF4478
Western blot shows lysates of LNCaP human prostate cancer cell line, HeLa human cervical epithelial carcinoma cell line and human liver tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CEACAM‑7 at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
CEACAM‑7 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Sheep Anti-Human CEACAM‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4478) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cell surfaces of cancer cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
Recombinant Human
PSG2 Protein
H00005670-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
ASAP1 Recombinant
Protein Antigen
NBP2-48909PEP
ASAP1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP) (0)

There are no publications for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP) (0)

There are no reviews for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP)

Discover related pathways, diseases and genes to ASAP1 Recombinant Protein Antigen (NBP2-48909PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP)

Discover more about diseases related to ASAP1 Recombinant Protein Antigen (NBP2-48909PEP).
 

Pathways for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP)

View related products by pathway.

PTMs for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP)

Learn more about PTMs related to ASAP1 Recombinant Protein Antigen (NBP2-48909PEP).

Blogs on ASAP1

There are no specific blogs for ASAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human ASAP1 Protein
H00050807-Q01-10ug
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.
p19ARF Antibody
NB200-106
Immunocytochemistry/Immunofluorescence: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Analysis of phosphorylated ASAP1present in mouse NIH3T3 cells transfected with activated Src. Specific staining is not present when antibody is pre-incubated with the immunizing peptide prior to reaction with cells.
ASAP1 [p Tyr782] Antibody
NBP1-77933
Western Blot: Serpin E1/PAI-1 Antibody [NBP1-19773] - Extracts from Jurkat cells.
Serpin E1/PAI-1 Antibody
NBP1-19773

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASAP1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ASAP1