ASAP1 Recombinant Protein Antigen

Images

 
There are currently no images for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ASAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ASAP1.

Source: E. coli

Amino Acid Sequence: PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48909.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ASAP1 Recombinant Protein Antigen

  • 130 kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activatingprotein
  • AMAP1
  • ARF GTPase-activating protein 1
  • arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
  • ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  • centaurin, beta 4
  • CENTB4
  • DDEF1ADP-ribosylation factor-directed GTPase-activating protein 1
  • development and differentiation enhancing factor 1
  • Development and differentiation-enhancing factor 1
  • Differentiation-enhancing factor 1
  • KIAA1249DEF-1
  • PAG2
  • PAP
  • PIP2-dependent ARF1 GAP
  • ZG14P

Background

ASAP1 (also known as AMAP1, 130-kDa phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating protein, PIP2-dependent ARF1 GAP,ADP-ribosylation factor-directed GTPase-activating protein 1, ARF GTPase-activating protein 1, Development and differentiation-enhancing factor 1, Differentiation-enhancing factor 1, DEF-1) is an Arf-directed GTPase activating protein that is a substrate for the kinases Src and FAK and has been implicated in the regulation of membrane traffic, focal adhesions and invadopodia/podosomes. Phosphorylation of ASAP1 at tyrosine 782 has been found to affect enzymatic and some biological activities, including the function of invadopodia. ASAP1 is expressed in many tissues but is most abundant in the testis, brain, lung and spleen. A heightened expression was seen in the adipose tissue from obese (ob) and diabetic (db) animals. Multiple transcript variants have been reported for this protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NBP3-48658
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF1148
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
NBP2-48860
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-95202
Species: Hu, Mu, Rt
Applications: WB
NBP2-43686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
DSE100
Species: Hu
Applications: ELISA
MAB41281
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
AF4478
Species: Hu
Applications: IHC, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
NBP2-48909PEP
Species: Hu
Applications: AC

Publications for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP) (0)

There are no publications for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP) (0)

There are no reviews for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ASAP1 Products

Research Areas for ASAP1 Recombinant Protein Antigen (NBP2-48909PEP)

Find related products by research area.

Blogs on ASAP1

There are no specific blogs for ASAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ASAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASAP1