ARPC5 Antibody (2D10) - Azide and BSA Free

Sandwich ELISA: ARPC5 Antibody (2D10) [H00010092-M02] - Detection limit for recombinant GST tagged ARPC5 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2D10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ARPC5 Antibody (2D10) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ARPC5 Antibody (2D10) - Azide and BSA Free (H00010092-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ARPC5 (NP_005708.1, 3 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKA
• Specificity: Reacts with actin related protein 2/3 complex, subunit 5, 16kDa.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ARPC5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARPC5 Antibody (2D10) - Azide and BSA Free

• actin related protein 2/3 complex, subunit 5, 16kDa
• ARC16subunit 5 (16 kD)
• MGC88523

Background

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARPC5
• Entrez:
  • 10092(Human)
• Uniprot:
  • NP_005708(Human)