ARP10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ARP10 Antibody [NBP3-17215] - Staining of human cell line REH shows localization to nucleoplasm & cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARP10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARP10 Antibody - BSA Free (NBP3-17215) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOBEC3H
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARP10 Antibody - BSA Free

• APOBEC-related protein 10
• apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
• ARP-10
• ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H
• DNA dC->dU-editing enzyme APOBEC-3H
• EC 3.5.4.-

Background

Members of the APOBEC family of proteins, like APOBEC3H, are mRNA editing enzymes that affect protein diversity by deamination of cytidine to produce uridine (Wedekind et al., 2003 [PubMed 12683974]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOBEC3H