APOBEC3D Antibody Summary
Immunogen |
Synthetic peptides corresponding to APOBEC3D (apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative)) The peptide sequence was selected from the N terminal of APOBEC3D (NP_689639). Peptide sequence: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
APOBEC3D |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 12 ug/ml
- Immunohistochemistry-Paraffin 12 ug/ml
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS & 2% Sucrose. |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for APOBEC3D Antibody
Background
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Simple Western, WB
Species: Hu
Applications: Flow, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP (-), Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: WB, IHC, IHC-P
Publications for APOBEC3D Antibody (NBP1-57440) (0)
There are no publications for APOBEC3D Antibody (NBP1-57440).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for APOBEC3D Antibody (NBP1-57440) (0)
There are no reviews for APOBEC3D Antibody (NBP1-57440).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for APOBEC3D Antibody (NBP1-57440) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional APOBEC3D Products
Bioinformatics Tool for APOBEC3D Antibody (NBP1-57440)
Discover related pathways, diseases and genes to APOBEC3D Antibody (NBP1-57440). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for APOBEC3D Antibody (NBP1-57440)
Discover more about diseases related to APOBEC3D Antibody (NBP1-57440).
| | Pathways for APOBEC3D Antibody (NBP1-57440)
View related products by pathway.
|
Research Areas for APOBEC3D Antibody (NBP1-57440)
Find related products by research area.
|
Blogs on APOBEC3D