APOBEC3D Antibody

Western Blot: APOBEC3D Antibody [NBP1-57440] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml

Immunohistochemistry-Paraffin: APOBEC3D Antibody [NBP1-57440] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

APOBEC3D Antibody Summary

• Immunogen: Synthetic peptides corresponding to APOBEC3D (apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative)) The peptide sequence was selected from the N terminal of APOBEC3D (NP_689639). Peptide sequence: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOBEC3D
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 12 ug/ml
  • Immunohistochemistry-Paraffin 12 ug/ml
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for APOBEC3D Antibody

• APOBEC3DE
• APOBEC3E
• apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative)
• apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D
• apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene
• ARP6
• DNA dC->dU-editing enzyme APOBEC-3D
• EC 3.5.4
• EC 3.5.4.-
• probable DNA dC->dU-editing enzyme APOBEC-3D

Background

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOBEC3D
• Entrez:
  • 140564(Human)
• Uniprot:
  • Q96AK3(Human)