ARP10 Antibody

Images

 
Western Blot: ARP10 Antibody [NBP1-91682] - Endogenous APOBEC3H stability/instability occurs at the protein level. Immunoblots showing endogenous A3H, A3G, and HSP90 protein levels in stimulated primary T lymphocytes ...read more
Western Blot: ARP10 Antibody [NBP1-91682] - A) APOBEC3H (A3H) haplotype II SV183 and various mutants expressed in 293T cells. B) The Novus anti-ARP10 antibody detected two splice variants of A3H, SV183 and SV200 in ...read more
Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human pancreas shows strong cytoplasmic granular positivity in a subset of exocrine glandular cells.
Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
Generation and validation of HIV-1 Vif separation-of-function molecular/viral probes. B) Immunoblots showing the expression levels of the indicated A3 proteins stably expressed in SupT11 cells. In this experiment ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARP10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKQS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOBEC3H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence -Reported in scientific literature (PMID 27650891)
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot - Reported in scientific literature (PMID: 25411794)/verified customer review.
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ARP10 Protein (NBP1-91682PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-91682 in the following applications:

Publications
Read Publications using
NBP1-91682 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARP10 Antibody

  • APOBEC-related protein 10
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
  • ARP-10
  • ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H
  • DNA dC->dU-editing enzyme APOBEC-3H
  • EC 3.5.4.-

Background

Members of the APOBEC family of proteins, like APOBEC3H, are mRNA editing enzymes that affect protein diversity by deamination of cytidine to produce uridine (Wedekind et al., 2003 [PubMed 12683974]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARP10 Antibody (NBP1-91682)(10)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, PAGE, WB.


Filter By Application
ICC/IF
(3)
PAGE
(1)
WB
(5)
All Applications
Filter By Species
Human
(7)
All Species
Showing Publications 1 - 10 of 10.
Publications using NBP1-91682 Applications Species
Ikeda, T;Shimizu, R;Nasser, H;Carpenter, MA;Cheng, AZ;Brown, WL;Sauter, D;Harris, RS; APOBEC3 degradation is the primary function of HIV-1 Vif determining virion infectivity in the myeloid cell line THP-1 mBio 2023-08-09 [PMID: 37555667]
Ikeda T, Shimizu R, Nasser H et al. APOBEC3 degradation is the primary function of HIV-1 Vif for virus replication in the myeloid cell line THP-1 bioRxiv : the preprint server for biology 2023-03-29 [PMID: 37034786] (PAGE, Human)

Details:
Dilutions: 1:5000
PAGE Human
Law EK, Levin-Klein R, Jarvis MC et al. APOBEC3A catalyzes mutation and drives carcinogenesis in vivo Journal of Experimental Medicine 2020-12-07 [PMID: 32870257] (WB) WB
Wang J, Becker JT, Shi K et al. The Role of RNA in HIV-1 Vif-Mediated Degradation of APOBEC3H J. Mol. Biol. 2019-10-16 [PMID: 31628948] (WB, Human) WB Human
Ebrahimi D, Richards CM, Carpenter MA et al. Genetic and mechanistic basis for APOBEC3H alternative splicing, retrovirus restriction, and counteraction by HIV-1 protease. Nat Commun. 2018-10-08 [PMID: 30297863] (WB, Human) WB Human
Salamango DJ, Becker JT, McCann JL et al. APOBEC3H Subcellular Localization Determinants Define Zipcode for Targeting HIV-1 for Restriction. Mol. Cell. Biol. 2018-09-17 [PMID: 30224517] (ICC/IF, Human) ICC/IF Human
Shaban Na, Shi-k, Lauer-k et al. The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism. Mol Cell. [PMID: 29290613] (WB, ICC/IF, Human) WB, ICC/IF Human
Ooms M, Letko M, Simon V. The Structural Interface between HIV-1 Vif and Human APOBEC3H. J Virol 2017-03-01 [PMID: 28031368]
Starrett GJ, Luengas EM, McCann JL et al. The DNA cytosine deaminase APOBEC3H haplotype I likely contributes to breast and lung cancer mutagenesis Nat Commun 2016-09-21 [PMID: 27650891] (ICC/IF, Human) ICC/IF Human
Refsland Ew, Hultquist Jf, Luengas Em et al. Natural Polymorphisms in Human APOBEC3H and HIV-1 Vif Combine in Primary T Lymphocytes to Affect Viral G-to-A Mutation Levels and Infectivity. PLoS Genet. 2014-11-01 [PMID: 25411794] (WB, Human) WB Human

Review for ARP10 Antibody (NBP1-91682) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-91682:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot ARP10 NBP1-91682
Enlarge
5
reviewed by:
Michael Carpenter
WB Human 11/17/2017
View

Summary

ApplicationWestern Blot
Sample Tested293T and MCF-7 cell lysates
SpeciesHuman
LotA96432

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARP10 Antibody (NBP1-91682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Michael Carpenter
11/17/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol APOBEC3H
Entrez
Uniprot