ARP10 Antibody

Western Blot: ARP10 Antibody [NBP1-91682] - Endogenous APOBEC3H stability/instability occurs at the protein level. Immunoblots showing endogenous A3H, A3G, and HSP90 protein levels in stimulated primary T lymphocytes from 4 donors with the indicated A3H haplotypes (donors 10, 11, 12, and 18). In this experiment endogenous A3H is detected with a polyclonal rabbit antibody. Image collected and cropped by CiteAb from the following publication (//journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1004761), licensed under a CC-BY licence.

Immunohistochemistry-Paraffin: ARP10 Antibody [NBP1-91682] - Staining of human tonsil shows strong cytoplasmic positivity in rare non-germinal center cells.

Western Blot: ARP10 Antibody [NBP1-91682] - A) APOBEC3H (A3H) haplotype II SV183 and various mutants expressed in 293T cells. B) The Novus anti-ARP10 antibody detected two splice variants of A3H, SV183 and SV200 in MCF-7 cell lysates. Transient transfection, overnight incubation with primary. WB image submitted by a verified customer review.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ARP10 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKQS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APOBEC3H
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Use in ICC/IF reported in scientific literature (PMID 27650891). WB reported in the scientific literature (PMID: 25411794). ARP10 antibody validated for WB from a verified customer review.
• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ARP10 Protein (NBP1-91682PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARP10 Antibody

• APOBEC-related protein 10
• apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
• ARP-10
• ARP10Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3H
• DNA dC->dU-editing enzyme APOBEC-3H
• EC 3.5.4.-

Background

Members of the APOBEC family of proteins, like APOBEC3H, are mRNA editing enzymes that affect protein diversity by deamination of cytidine to produce uridine (Wedekind et al., 2003 [PubMed 12683974]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARP10 Antibody (NBP1-91682)(7)

Publications using NBP1-91682

• Wang J, Becker JT, Shi K et al. The Role of RNA in HIV-1 Vif-Mediated Degradation of APOBEC3H J. Mol. Biol. 2019-10-16 [PMID: 31628948] (WB, Human)
• Ebrahimi D, Richards CM, Carpenter MA et al. Genetic and mechanistic basis for APOBEC3H alternative splicing, retrovirus restriction, and counteraction by HIV-1 protease. Nat Commun. 2018-10-08 [PMID: 30297863] (WB, Human)
• Salamango DJ, Becker JT, McCann JL et al. APOBEC3H Subcellular Localization Determinants Define Zipcode for Targeting HIV-1 for Restriction. Mol. Cell. Biol. 2018-09-17 [PMID: 30224517] (ICC/IF, Human)
• Shaban Na, Shi-k, Lauer-k et al. The Antiviral and Cancer Genomic DNA Deaminase APOBEC3H Is Regulated by an RNA-Mediated Dimerization Mechanism. Mol Cell. [PMID: 29290613] (ICC/IF, WB, Human)
• Ooms M, Letko M, Simon V. The Structural Interface between HIV-1 Vif and Human APOBEC3H. J Virol 2017-03-01 [PMID: 28031368]
• Starrett GJ, Luengas EM, McCann JL et al. The DNA cytosine deaminase APOBEC3H haplotype I likely contributes to breast and lung cancer mutagenesis Nat Commun 2016-09-21 [PMID: 27650891] (ICC/IF, Human)
• Refsland Ew, Hultquist Jf, Luengas Em et al. Natural Polymorphisms in Human APOBEC3H and HIV-1 Vif Combine in Primary T Lymphocytes to Affect Viral G-to-A Mutation Levels and Infectivity. PLoS Genet. 2014-11-01 [PMID: 25411794] (WB, Human)

Review for ARP10 Antibody (NBP1-91682) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 11/17/2017

Summary

• Application: Western Blot
• Sample Tested: 293T and MCF-7 cell lysates
• Species: Human
• Lot: A96432

Bioinformatics

• Gene Symbol: APOBEC3H
• Entrez:
  • 164668(Human)
• Uniprot:
  • Q6NTF7(Human)