Home » ARNTL2 » ARNTL2 Antibodies » ARNTL2 Antibody

ARNTL2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ARNTL2 Antibody [NBP1-69002] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.
Western Blot: ARNTL2 Antibody [NBP1-69002] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ARNTL2 Antibody Summary

Immunogen
The immunogen for anti-Arntl2 antibody: synthetic peptide corresponding to a region of Mouse ARNTL2 (NP_758513). Peptide sequence AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARNTL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
Detects a 64 kDa band in mouse heart samples.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARNTL2 Antibody

  • Aryl hydrocarbon receptor nuclear translocator-like protein 2
  • Basic-helix-loop-helix-PAS protein MOP9
  • bHLHe6
  • BMAL2
  • Brain and muscle ARNT-like 2
  • Class E basic helix-loop-helix protein 6
  • CLIF
  • CYCLE-like factor
  • Member of PAS protein 9
  • MOP9
  • PAS domain-containing protein 9
  • PASD9
  • Transcription Factor BMAL2

Background

ARNTL2/CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, Arntl2 activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BMAL1 Antibody
NB100-2288
Flow (Intracellular): BMAL1 Antibody [NB100-2288] - An intracellular stain was performed on HeLa cells with NB100-2288AF647(blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunohistochemistry: BMAL1 Antibody [NB100-2288] - Analysis of BMAL1 in mouse cerebral cortex (left: wt, right: Bmal1 KO) using anti-BMAL1 antibody. Image from verified customer review.
Flow Cytometry: BMAL1 Antibody [NB100-2288] - An intracellular stain was performed on Jurkat cells with NB100-2288 and a matched isotype control. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(1 Review)
(39 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
CLOCK Antibody
NB100-126
Western Blot: CLOCK Antibody [NB100-126] - Lanes 3-5 contained alpha CLOCK immunoprecipitated mouse DNA (15, 10 and 5 ul of antisera added respectively to the 900 ul of sonicated chromatin sample in the ChIP assay.
(3 Publications)
Species: Hu, Mu
Applications: ChIP, WB
PER1 Antibody
NBP2-24589
Immunohistochemistry-Paraffin: PER1 Antibody [NBP2-24589] - Human brain tissue using an isotype control (top) and NBP2-24589 (bottom) at 5 ug/ml.
Western Blot: PER1 Antibody [NBP2-24589] - Analysis of PER1 in HEPG2 cell lysates in the 1) absence and 2) presence of immunizing peptide using NBP2-24589. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
(1 Review)
(2 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
PER2 Antibody -
BSA Free
NB100-125
Western Blot: PER2 Antibody [NB100-125] - Western Blot Usage of NB100-125. Image submitted via verified customer review.
Immunocytochemistry/Immunofluorescence: PER2 Antibody [NB100-125] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PER2 Antibody at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunocytochemistry/Immunofluorescence: PER2 Antibody [NB100-125] - U-87 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-PER2 Antibody at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Serpin E1/PAI-1
[HRP]
DSE100
(40 Publications)
Species: Hu
Applications: ELISA
PGAP3 Antibody
NBP3-12196
Immunohistochemistry-Paraffin: PGAP3 Antibody [NBP3-12196] - 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnification. FFPE section.
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Plasminogen
Antibody
NB600-930
Western Blot: Plasminogen Antibody [NB600-930] - Detection of Plasminogen under reducing (R) and non-reducing (NR) conditions. Reduced samples of purified target proteins contained 4% BME and were boiled for 5 minutes. Samples of 1ug of protein per lane were run by SDS-PAGE. Protein was transferred to nitrocellulose and probed with 1:3000 dilution of primary antibody. Detection shown was using Dylight 649 conjugated Donkey anti goat 1 hr RT.
Western Blot: Plasminogen Antibody [NB600-930] - Lane 1: Plasminogen. Lane 2: None. Load: 50 ng per lane. Primary antibody: Plasminogen primary antibody at 1:1,000 overnight at 4C. Secondary antibody: Peroxidase goat secondary antibody at 1:40,000 for 60 min at RT. Blocking: incubated with blocking buffer for 30 min at RT. Predicted/Observed size: 91 kDa, 91 kDa for Plasminogen. Other band(s): None.
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: ELISA, WB
NPAS2 Antibody
NBP1-88612
Immunocytochemistry/Immunofluorescence: NPAS2 Antibody [NBP1-88612] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry: NPAS2 Antibody [NBP1-88612] - Staining of mouse brain shows moderate positivity of neurons in the cerebral cortex.
Immunohistochemistry-Paraffin: NPAS2 Antibody [NBP1-88612] - Staining of human cerebral cortex shows moderate nuclear positivity.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
CRY2 Antibody
(OTI1H5)
NBP2-00749
Flow Cytometry: CRY2 Antibody (1H5) [NBP2-00749] - Analysis of Hela cells, using anti-CRY2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: CRY2 Antibody (1H5) [NBP2-00749] - Analysis of Jurkat cells, using anti-CRY2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Immunohistochemistry-Paraffin: CRY2 Antibody (1H5) [NBP2-00749] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-CRY2 mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CRY1 Antibody
[Unconjugated]
AF3764
CRY1 was detected in immersion fixed MOLT‑4 human acute lymphoblastic leukemia cell line using Goat Anti-Human/Mouse CRY1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3764) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
DEC1 Antibody -
BSA Free
NB100-1800
Immunohistochemistry-Paraffin: DEC1 Antibody [NB100-1800] - P. gingivalis-challenged rat maxilla using DEC1 antibody at 1:100. Heat mediated antigen retrieval (sodium citrate buffer pH 6.0) was performed. Counter-stained with hematoxylin. Image from verified customer review.
Immunoblotting: DEC1 Antibody [NB100-1800] - (B) HSC-2 cells were used to perform knockdown assays for three primary antibodies: HIF1A, DEC1, and DEC2 9. Real-time RT-PCR evaluated expression levels of MSH2, MBD4, MRE11A, BRCA1, and RAD51. Value displayed above the bar represents the ratio of expression under hypoxic conditions compared with that under normoxia. Citation: Nakamura H, Bono H, Hiyama K, Kawamoto T, Kato Y, Nakanishi T, et al. (2018) Differentiated embryo chondrocyte plays a crucial role in DNA damage response via transcriptional regulation under hypoxic conditions. PLoS ONE 13(2): e0192136. https://doi.org/10.1371/journal.pone.0192136
Immunoblotting: DEC1 Antibody [NB100-1800] - DNA-DRR genes promoter activities decreased with DEC. (B) The DEC1 or DEC2 expression plasmids (B), each reporter, and DEC1 or delta basic DEC1 expression plasmids (C) were co-transfected into HepG2. Under normoxic conditions they were then incubated for 36 hours. A dual-luciferase assay system determined luciferase activities. Citation: Nakamura H, Bono H, Hiyama K, Kawamoto T, Kato Y, Nakanishi T, et al. (2018) Differentiated embryo chondrocyte plays a crucial role in DNA damage response via transcriptional regulation under hypoxic conditions. PLoS ONE 13(2): e0192136. https://doi.org/10.1371/journal.pone.0192136
(2 Reviews)
(30 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
ARNT/HIF-1 beta
Antibody (H1beta234) ...
NB100-124
Western Blot: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Western Blot analysis with ARNT/HIF-1 beta antibody (H1beta234) [NB100-124], theoretical molecular weight 86.6 kDa. Expression of CD44 mRNA in genetically engineered MDA-MB-231 cells. (A) Immunoblot analysis of HIF-1A or HIF-2A expression in whole cell extracts from MDA-MB-231 cells stably expressing EV, HIF-1A-shRNA or HIF-2A-shRNA under normoxia or in response to 4 h treatment with 200 uM CoCl2. HIF-1B expression was used as a loading control. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0044078) licensed under a CC-BY licence.
Western Blot: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - HIF was not the only factor stabilizing activated EGFR in VHL-deficient ccRCC cells. A. Western blot analysis of 786-VHL and 786-mock cells stably expressing shRNA constructs. For HIF2A (NB100-480) and ARNT/HIF-1 beta antibody (H1beta234)[NB100-124] analysis, nuclear extracts were generated and analyzed. Anti-HA blot detected HA-VHL. Means and SDs of three separate experiments were shown. Theoretical molecular weight for ARNT/HIF-1 beta is 86.6 kDa, observed molecular weight ~90 kDa. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0023936) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Co-localization of HIF-2alpha with ARNT/HIF-1 beta antibody (H1beta234) [NB100-124]. ICC/IF detecting indicated proteins using antibodies labelled with Alexa Fluor 555 (red, pseudocolour) and Alexa Fluor 488 (green, pseudocolour). 'Merge' is the red image superimposed onto the green image of the co-stained nuclear proteins. 'Coloc' is the co-localization channel calculated using ImageJ plugin. White indicates pixels where both red and green signal is found (i.e. co-localization). 'Overlay' is the co-localization image superimposed onto the merged image. Inlay is the magnified region (white square). White arrows highlight regions of co-localization. Scale bar, 5 um. Abbreviations: RNAPII, RNA Polymerase II phospho-serine 5. Image collected and cropped by CiteAb from the following publication (http://rsob.royalsocietypublishing.org/lookup/doi/10.1098/rsob.160195), licensed under a CC-BY licence.
(4 Reviews)
(100 Publications)
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
DEC2/SHARP1
Antibody - BSA Free
NBP1-19613
Western Blot: DEC2/SHARP1 Antibody [NBP1-19613] - Huh7 cell lysates loaded from left to right at concentrations of 20, 30, and 40 ug of total protein. Image from verified customer review.
Simple Western: DEC2/SHARP1 Antibody [NBP1-19613] - Image shows a specific band for SHARP1 in 0.5 mg/mL of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunohistochemistry-Paraffin: DEC2/SHARP1 Antibody [NBP1-19613] - Staining of SHARP1 in mouse pancreas.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
ATN1 Antibody
NBP1-90044
Immunocytochemistry/Immunofluorescence: ATN1 Antibody [NBP1-90044] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Analysis in human cerebral cortex and liver tissues. Corresponding ATN1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PER3 Antibody
NBP1-86436
Immunohistochemistry-Paraffin: PER3 Antibody [NBP1-86436] - Staining of human placenta shows strong positivity in erythrocytes.
Immunohistochemistry-Paraffin: PER3 Antibody [NBP1-86436] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PER3 Antibody [NBP1-86436] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
SBNO1 Antibody
NBP1-83837
Immunocytochemistry/Immunofluorescence: SBNO1 Antibody [NBP1-83837] - Staining of human cell line A549 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SBNO1 Antibody [NBP1-83837] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SBNO1 Antibody [NBP1-83837] - Staining of human endometrium shows moderate nuclear positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Immunofluorescence: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY HSD17B4.
Immunofluorescence: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of HeLa cells.
Immunohistochemistry: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of Human Ovary tissue.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
D Box Binding
Protein Antibody
NBP2-83997
Immunohistochemistry: D Box Binding Protein Antibody [NBP2-83997] - Human Liver
Western Blot: D Box Binding Protein Antibody [NBP2-83997] - WB Suggested Anti-DBP Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Western Blot: D Box Binding Protein Antibody [NBP2-83997] - Host: Rabbit. Target Name: DBP. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml
Species: Hu
Applications: IHC, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(18 Publications)
Species: Hu
Applications: BA
ARNTL2 Antibody
NBP1-69002
ARNTL2 Antibody
Species: Mu
Applications: WB

Publications for ARNTL2 Antibody (NBP1-69002) (0)

There are no publications for ARNTL2 Antibody (NBP1-69002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARNTL2 Antibody (NBP1-69002) (0)

There are no reviews for ARNTL2 Antibody (NBP1-69002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARNTL2 Antibody (NBP1-69002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARNTL2 Products

Bioinformatics Tool for ARNTL2 Antibody (NBP1-69002)

Discover related pathways, diseases and genes to ARNTL2 Antibody (NBP1-69002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARNTL2 Antibody (NBP1-69002)

Discover more about diseases related to ARNTL2 Antibody (NBP1-69002).
 

Pathways for ARNTL2 Antibody (NBP1-69002)

View related products by pathway.

Blogs on ARNTL2

There are no specific blogs for ARNTL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARNTL2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ARNTL2
Entrez
Uniprot