Home » ARNTL2 » ARNTL2 Antibodies » ARNTL2 Antibody

ARNTL2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ARNTL2 Antibody [NBP1-69002] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.
Western Blot: ARNTL2 Antibody [NBP1-69002] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ARNTL2 Antibody Summary

Immunogen
The immunogen for anti-Arntl2 antibody: synthetic peptide corresponding to a region of Mouse ARNTL2 (NP_758513). Peptide sequence AILGYLPQELLGTSCYEYFHQDDHSSLTDKHKAVLQSKEKILTDSYKFRV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARNTL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
Detects a 64 kDa band in mouse heart samples.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARNTL2 Antibody

  • Aryl hydrocarbon receptor nuclear translocator-like protein 2
  • Basic-helix-loop-helix-PAS protein MOP9
  • bHLHe6
  • BMAL2
  • Brain and muscle ARNT-like 2
  • Class E basic helix-loop-helix protein 6
  • CLIF
  • CYCLE-like factor
  • Member of PAS protein 9
  • MOP9
  • PAS domain-containing protein 9
  • PASD9
  • Transcription Factor BMAL2

Background

ARNTL2/CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, Arntl2 activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

BMAL1 Antibody
NB100-2288
Western Blot: BMAL1 Antibody [NB100-2288] - Analysis of BMAL1 in A) MCF7, B) NIH/3T3, C) PC12.
Immunocytochemistry/Immunofluorescence: BMAL1 Antibody [NB100-2288] - BMAL1 antibody was tested in HeLa cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: BMAL1 Antibody [NB100-2288] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse brain using 1:200 dilution of rabbit anti-BMAL1 antibody. The staining was developed using HRP labeled anti-rabbit IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This BMAL1 antibody generated a specific nuclear staining in most of the cells and a relatively weaker cytoplasmic signal was also observed.
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
CLOCK Antibody
NB100-126
Western Blot: CLOCK Antibody [NB100-126] - Lanes 3-5 contained alpha CLOCK immunoprecipitated mouse DNA (15, 10 and 5 ul of antisera added respectively to the 900 ul of sonicated chromatin sample in the ChIP assay.
(3 Publications)
Species: Hu, Mu
Applications: WB, ChIP
PER1 Antibody
NBP2-24589
Western Blot: PER1 Antibody [NBP2-24589] - Analysis of PER1 in HEPG2 cell lysates in the 1) absence and 2) presence of immunizing peptide using NBP2-24589. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: PER1 Antibody [NBP2-24589] - Immunohistochemical analysis of PER1 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top) and NBP2-24589 (bottom) at 5 ug/ml.
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
PER2 Antibody
NB100-125
Western Blot: PER2 Antibody [NB100-125] - WB analysis of PER2 expression on ARPE-19 whole cell lysate.
Immunocytochemistry/Immunofluorescence: PER2 Antibody [NB100-125] - The PER2 antibody was tested in ARPE-19 cells at a 1:250 dilution against Dylight 488 (Green). Alpha-tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue), respectively.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ICC/IF
Serpin E1/PAI-1
Antibody
NBP1-19773
Western Blot: Serpin E1/PAI-1 Antibody [NBP1-19773] - Extracts from Jurkat cells.
Immunocytochemistry/Immunofluorescence: Serpin E1/PAI-1 Antibody [NBP1-19773] - PAI1/Serpine1 antibody was tested in Hela cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: Serpin E1/PAI-1 Antibody [NBP1-19773] - Staining of PAI1/Serpine 1 in mouse pancreas.
(2 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
PGAP3 Antibody
NBP1-86692
Immunocytochemistry/Immunofluorescence: PGAP3 Antibody [NBP1-86692] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: PGAP3 Antibody [NBP1-86692] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Plasminogen
Antibody
NB600-930
Western Blot: Plasminogen Antibody [NB600-930] - Lane 1: Plasminogen. Lane 2: None. Load: 50 ng per lane. Primary antibody: Plasminogen primary antibody at 1:1,000 overnight at 4C. Secondary antibody: Peroxidase goat secondary antibody at 1:40,000 for 60 min at RT. Blocking: incubated with blocking buffer for 30 min at RT. Predicted/Observed size: 91 kDa, 91 kDa for Plasminogen. Other band(s): None.
Western Blot: Plasminogen Antibody [NB600-930] - Detection of Plasminogen under reducing (R) and non-reducing (NR) conditions. Reduced samples of purified target proteins contained 4% BME and were boiled for 5 minutes. Samples of 1ug of protein per lane were run by SDS-PAGE. Protein was transferred to nitrocellulose and probed with 1:3000 dilution of primary antibody. Detection shown was using Dylight 649 conjugated Donkey anti goat 1 hr RT.
Western Blot: Plasminogen Antibody [NB600-930] - Analysis using HRP conjugate of NB600-930. Detection of Plasminogen under reducing (R) and non-reducing (NR) conditions. Reduced samples of purified target proteins contained 4% BME and were boiled for 5 minutes. Samples of 1ug of protein per lane were run by SDS-PAGE. Protein was transferred to nitrocellulose and probed with 1:3000 dilution of primary antibody. Detection shown was using Dylight 649 conjugated Donkey anti goat 1 hr RT.
(2 Reviews)
(8 Publications)
Species: Hu, Ba
Applications: WB, ELISA
NPAS2 Antibody
NBP1-31363
Western Blot: NPAS2 Antibody [NBP1-31363] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with NPAS2 antibody [C1C3] diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: NPAS2 Antibody [NBP1-31363] - SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: NPAS2 protein stained by NPAS2 antibody [C1C3] diluted at 1:500. Red: Phalloidin, a cytoskeleton marker, diluted at 1:50. Scale bar = 10 um.
Immunohistochemistry-Frozen: NPAS2 Antibody [NBP1-31363] - Frozen sectioned E13.5 Rat brain. Green: NPAS2 protein stained by NPAS2 antibody [C1C3] diluted at 1:250. Red: beta Tubulin 3/ TUJ1, a mature neuron marker, stained by beta Tubulin 3/ TUJ1 antibody [11710] (NBP2-43559) diluted at 1:500. Blue: Fluoroshield with DAPI.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
CRY2 Antibody
(OTI1H5)
NBP2-00749
Western Blot: CRY2 Antibody (1H5) [NBP2-00749] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CRY2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-CRY2.
Immunocytochemistry/Immunofluorescence: CRY2 Antibody (1H5) [NBP2-00749] Staining of COS7 cells transiently transfected by pCMV6-ENTRY CRY2.
Immunohistochemistry-Paraffin: CRY2 Antibody (1H5) [NBP2-00749] - Staining of paraffin-embedded Human lymphoma tissue using anti-CRY2 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
CRY1 Antibody
[Unconjugated]
AF3764
CRY1 was detected in immersion fixed MOLT‑4 human acute lymphoblastic leukemia cell line using Goat Anti-Human/Mouse CRY1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3764) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu, Mu
Applications: WB, IHC, ICC
DEC1 Antibody
NB100-1800
Western Blot: DEC1 Antibody [NB100-1800] - Western Blot Image of anti-DEC1. Whole cell protein from A431 (lane 1) and PC3 (lane 2) was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-DEC1 in 1% milk, and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: DEC1 Antibody [NB100-1800] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-DEC1 (NB100-1800) at a 1:200 dilution overnight at 4C and detected with and anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin was used as a co-stain at a 1:1000 dilution and detected with and anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Western Blot: DEC1 Antibody [NB100-1800] - Western blot analysis of DEC1 in HeLa whole cell lysate.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
ARNT/HIF-1 beta
Antibody (H1beta234)
NB100-124
Western Blot: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Analysis of HIF-1 beta in HeLa nuclear extract.
Immunocytochemistry/Immunofluorescence: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-HIF-1 beta (H1beta234) at 5ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry: ARNT/HIF-1 beta Antibody (H1beta234) [NB100-124] - Staining of human glioblastoma multi-forme utilizing anti-HIF-1 Beta.
(1 Review)
(90 Publications)
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
DEC2/SHARP1
Antibody
NBP1-19613
Western Blot: DEC2/SHARP1 Antibody [NBP1-19613] - Western blot analysis of HeLa (1), Raw 264.7 (2), A431 (3), MCF7 (4), and PC12 (5) using SHARP1 antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: DEC2/SHARP1 Antibody [NBP1-19613] - Staining of SHARP1 in mouse pancreas.
Western Blot: DEC2/SHARP1 Antibody [NBP1-19613] - WB analysis of SHARP1 in HeLa whole cell extract.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
ATN1 Antibody
NBP1-90044
Immunocytochemistry/Immunofluorescence: ATN1 Antibody [NBP1-90044] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Staining in human cerebral cortex and liver tissues using anti-ATN1 antibody. Corresponding ATN1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ATN1 Antibody [NBP1-90044] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PER3 Antibody
H00008863-B01P
Western Blot: PER3 Antibody [H00008863-B01P] - Analysis of PER3 expression in transfected 293T cell line by PER3 polyclonal antibody. Lane 1: PER3 transfected lysate(41.58 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: PER3 Antibody [H00008863-B01P] - Analysis of purified antibody to PER3 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: WB, ICC/IF
SBNO1 Antibody
NBP1-83837
Western Blot: SBNO1 Antibody [NBP1-83837] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: SBNO1 Antibody [NBP1-83837] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SBNO1 Antibody [NBP1-83837] - Staining of human colon shows strong nuclear positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Western Blot: HSD17B4 Antibody (4C4) [NBP2-46005] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HSD17B4.
Immunohistochemistry: HSD17B4 Antibody (4C4) [NBP2-46005] - Analysis of Carcinoma of Human liver tissue.
Immunohistochemistry: HSD17B4 Antibody (4C4) [NBP2-46005] - Analysis of Human Ovary tissue.
(1 Review)
Species: Hu
Applications: WB, IHC, IF
D Box Binding
Protein Knockout 293T ...
NBP2-65684
D Box Binding Protein Knockout 293T Cell Lysate
Species: Hu
LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(10 Publications)
Species: Hu
ARNTL2 Antibody
NBP1-69002
ARNTL2 Antibody
Species: Mu
Applications: WB

Publications for ARNTL2 Antibody (NBP1-69002) (0)

There are no publications for ARNTL2 Antibody (NBP1-69002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARNTL2 Antibody (NBP1-69002) (0)

There are no reviews for ARNTL2 Antibody (NBP1-69002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARNTL2 Antibody (NBP1-69002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARNTL2 Products

Bioinformatics Tool for ARNTL2 Antibody (NBP1-69002)

Discover related pathways, diseases and genes to ARNTL2 Antibody (NBP1-69002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARNTL2 Antibody (NBP1-69002)

Discover more about diseases related to ARNTL2 Antibody (NBP1-69002).
 

Pathways for ARNTL2 Antibody (NBP1-69002)

View related products by pathway.

Blogs on ARNTL2

There are no specific blogs for ARNTL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARNTL2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ARNTL2
Entrez
Uniprot