ARMC10 Antibody

Images

 
Orthogonal Strategies: Western Blot: ARMC10 Antibody [NBP1-81127] - Analysis in human cell lines MCF-7 and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: ARMC10 Antibody [NBP1-81127] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ARMC10 Antibody [NBP1-81127] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: ARMC10 Antibody [NBP1-81127] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: ARMC10 Antibody [NBP1-81127] - Staining of human colon shows moderate to strong granular cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: ARMC10 Antibody [NBP1-81127] - Staining of human cerebral cortex, colon, skeletal muscle and testis using Anti-ARMC10 antibody NBP1-81127 (A) shows similar ...read more
Immunohistochemistry-Paraffin: ARMC10 Antibody [NBP1-81127] - Staining of human skeletal muscle shows very weak positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARMC10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKLLLNLSENPAMTEGLLRAQVDSSFLSLYDSHVAKEILLRVLTLFQNIKNCLKIEGHLAVQPTFTEGSLFFLLHGEECAQKIRALVDHHDAEVKEKVVTIIPKI
Specificity
Specificity of human ARMC10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARMC10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
WB reported in scientific literature (PMID: 29092660). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using NBP1-81127.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARMC10 Antibody

  • armadillo repeat containing 10
  • armadillo repeat-containing protein 10
  • FLJ37850
  • MGC3195
  • specific splicing variant involved in hepatocarcinogenesis
  • Splicing variant involved in hepatocarcinogenesis protein
  • SVHPNAS112

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89142
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-80461
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83309
Species: Hu
Applications: WB, ICC/IF
NBP1-88982
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46218
Species: Hu
Applications: WB, IHC
NBP2-76827
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-59333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
AF5530
Species: Hu
Applications: WB
NB600-1081
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
NBP1-59021
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02340
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for ARMC10 Antibody (NBP1-81127)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for ARMC10 Antibody (NBP1-81127) (0)

There are no reviews for ARMC10 Antibody (NBP1-81127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARMC10 Antibody (NBP1-81127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARMC10 Products

Bioinformatics Tool for ARMC10 Antibody (NBP1-81127)

Discover related pathways, diseases and genes to ARMC10 Antibody (NBP1-81127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMC10 Antibody (NBP1-81127)

Discover more about diseases related to ARMC10 Antibody (NBP1-81127).

Blogs on ARMC10

There are no specific blogs for ARMC10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMC10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMC10
Entrez
Uniprot
COVID-19 update