New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

ARL5B Antibody

Images

 
Western Blot: ARL5B Antibody [NBP2-83939] - Host: Rabbit. Target Name: ARL5B. Sample Tissue: Human 786-0 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL5B Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARL5B. Peptide sequence: KNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELY The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ARL5B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARL5B Antibody

  • ADP-ribosylation factor-like 5B
  • ADP-ribosylation factor-like 8
  • ADP-ribosylation factor-like protein 5B
  • ADP-ribosylation factor-like protein 8
  • ADP-ribosylation-like factor 8
  • ARL8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-77089
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBL1-10259
Species: Hu
Applications: WB
NBP2-58197
Species: Hu
Applications: ICC/IF, WB
AF4876
Species: Hu
Applications: WB
NBP1-88988
Species: Hu
Applications: ICC/IF, KD, WB
NBP2-15465
Species: Hu
Applications: IHC, IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-86170
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92831
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-94173
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-21667
Species: Hu
Applications: ELISA, ICC/IF, IHC, PAGE, WB
NBP1-88523
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-49643
Species: Bv, Hu, Pm, Mu
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB
NBP2-92876
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-46238
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00006192-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for ARL5B Antibody (NBP2-83939) (0)

There are no publications for ARL5B Antibody (NBP2-83939).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL5B Antibody (NBP2-83939) (0)

There are no reviews for ARL5B Antibody (NBP2-83939). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL5B Antibody (NBP2-83939) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL5B Products

Bioinformatics Tool for ARL5B Antibody (NBP2-83939)

Discover related pathways, diseases and genes to ARL5B Antibody (NBP2-83939). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL5B Antibody (NBP2-83939)

Discover more about diseases related to ARL5B Antibody (NBP2-83939).
 

Pathways for ARL5B Antibody (NBP2-83939)

View related products by pathway.

PTMs for ARL5B Antibody (NBP2-83939)

Learn more about PTMs related to ARL5B Antibody (NBP2-83939).
 

Research Areas for ARL5B Antibody (NBP2-83939)

Find related products by research area.

Blogs on ARL5B

There are no specific blogs for ARL5B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL5B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL5B