ARL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARL2 Antibody [NBP1-91680] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ARL2 Antibody [NBP1-91680] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTA
Specificity
Specificity of human ARL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARL2 Protein (NBP1-91680PEP)
Publications
Read Publication using NBP1-91680.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARL2 Antibody

  • ADP-ribosylation factor-like 2
  • ADP-ribosylation factor-like protein 2
  • ARFL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-71743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49101
Species: Hu
Applications: IHC, IHC-P
NBP2-46542
Species: Hu
Applications: WB, IHC
H00009094-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-93954
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15461
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
MAB7185
Species: Hu
Applications: WB, Simple Western
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB120-5663
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32731
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ARL2 Antibody (NBP1-91680)(1)

Reviews for ARL2 Antibody (NBP1-91680) (0)

There are no reviews for ARL2 Antibody (NBP1-91680). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARL2 Antibody (NBP1-91680) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARL2 Products

Bioinformatics Tool for ARL2 Antibody (NBP1-91680)

Discover related pathways, diseases and genes to ARL2 Antibody (NBP1-91680). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL2 Antibody (NBP1-91680)

Discover more about diseases related to ARL2 Antibody (NBP1-91680).
 

Pathways for ARL2 Antibody (NBP1-91680)

View related products by pathway.

PTMs for ARL2 Antibody (NBP1-91680)

Learn more about PTMs related to ARL2 Antibody (NBP1-91680).
 

Research Areas for ARL2 Antibody (NBP1-91680)

Find related products by research area.

Blogs on ARL2

There are no specific blogs for ARL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL2