ARID5B Antibody


Western Blot: ARID5B Antibody [NBP1-69169] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ARID5B Antibody Summary

Synthetic peptides corresponding to ARID5B (AT rich interactive domain 5B (MRF1-like)) The peptide sequence was selected from the C terminal of ARID5B (NP_115575). Peptide sequence: VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ARID5B and was validated on Western blot.
Theoretical MW
132 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARID5B Antibody

  • ARID domain-containing protein 5B
  • AT rich interactive domain 5B (MRF1-like)
  • DESRTAT-rich interactive domain-containing protein 5B
  • FLJ21150
  • modulator recognition factor 2 (MRF2)
  • Modulator recognition factor 2
  • MRF-2
  • MRF2MRF1-like protein


ARID5B is a DNA-binding protein that binds to the 5'-AATA[CT]-3' core sequence. ARID5B probably acts as a transcription regulator. ARID5B represses the cytomegalovirus enhancer. Overexpression of ARID5B leads to induction of smooth muscle marker genes, suggesting that it may act as a regulator of smooth muscle cell differentiation and proliferation. ARID5B may be involved in lipid stores.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for ARID5B Antibody (NBP1-69169) (0)

There are no publications for ARID5B Antibody (NBP1-69169).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARID5B Antibody (NBP1-69169) (0)

There are no reviews for ARID5B Antibody (NBP1-69169). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARID5B Antibody (NBP1-69169) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ARID5B Products

Bioinformatics Tool for ARID5B Antibody (NBP1-69169)

Discover related pathways, diseases and genes to ARID5B Antibody (NBP1-69169). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARID5B Antibody (NBP1-69169)

Discover more about diseases related to ARID5B Antibody (NBP1-69169).

Pathways for ARID5B Antibody (NBP1-69169)

View related products by pathway.

PTMs for ARID5B Antibody (NBP1-69169)

Learn more about PTMs related to ARID5B Antibody (NBP1-69169).

Blogs on ARID5B

There are no specific blogs for ARID5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARID5B Antibody and receive a gift card or discount.


Gene Symbol ARID5B