ARID1B Antibody (2D2)

Images

 
Western Blot: ARID1B Antibody (2D2) [H00057492-M01] - ARID1B monoclonal antibody (M01), clone 2D2 Analysis of ARID1B expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: ARID1B Antibody (2D2) [H00057492-M01] - Analysis of monoclonal antibody to ARID1B on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: ARID1B Antibody (2D2) [H00057492-M01] - Analysis of monoclonal antibody to ARID1B on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
ELISA: ARID1B Antibody (2D2) [H00057492-M01] - Detection limit for recombinant GST tagged ARID1B is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
2D2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARID1B Antibody (2D2) Summary

Immunogen
ARID1B (NP_059989, 1364 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Specificity
ARID1B - AT rich interactive domain 1B (SWI1-like)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARID1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00057492-M01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARID1B Antibody (2D2)

  • 6A3-5
  • ARID domain-containing protein 1B
  • AT rich interactive domain 1B (SWI1-like)
  • BAF250B
  • BRG1-associated factor 250b
  • BRG1-binding protein ELD/OSA1
  • BRG1-binding protein hELD/OSA1
  • BRIGHT
  • DAN15P250R
  • ELD (eyelid)/OSA protein
  • ELD/OSA1
  • hOsa2
  • JPUT1
  • KDM5B
  • KIAA1235AT-rich interactive domain-containing protein 1B
  • Osa homolog 2
  • OSA2
  • p250R
  • PLU1
  • RBBP2H1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88932
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-66840
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-00932
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00008815-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB100-79833
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-43567
Species: Hu, Mu
Applications: ICC/IF, KO, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-76825
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-90013
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP2-20415
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP1-30941
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2242
Species: Hu, Mu
Applications: ChIP, IP, WB
NBP2-95239
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
1705-HH/CF
Species: Hu, Mu
Applications: BA
NBP1-28727
Species: Hu
Applications: IHC, IHC-P, IP (-), IP, WB

Publications for ARID1B Antibody (H00057492-M01)(8)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species
Showing Publications 1 - 8 of 8.
Publications using H00057492-M01 Applications Species
Kobel M, Hoang LN, Tessier-Cloutier B et al. Undifferentiated Endometrial Carcinomas Show Frequent Loss of Core Switch/Sucrose Nonfermentable Complex Proteins. Am J Surg Pathol 2018 Jan [PMID: 28863077] (Human) Human
Agnihotri S, Jalali S, Wilson MR et al. The genomic landscape of schwannoma. Nat Genet 2016 Nov [PMID: 27723760]
Coatham M, Li X, Karnezis AN et al. Concurrent ARID1A and ARID1B inactivation in endometrial and ovarian dedifferentiated carcinomas. Mod Pathol 2016 Aug 26 [PMID: 27562491]
Aso T, Uozaki H, Morita S et al. Loss of ARID1A, ARID1B, and ARID2 Expression During Progression of Gastric Cancer. Anticancer Res 2015 Dec [PMID: 26637902]
Yoshimoto T, Matsubara D1, Nakano T et al. Frequent loss of the expression of multiple subunits of the SWI/SNF complex in large cell carcinoma and pleomorphic carcinoma of the lung. Pathol Int. 2015 Sep 08 [PMID: 26345631]
Chory EJ, Kirkland JG, Chang CD'Andrea V Inhibition of a Selective SWI/SNF Function Synergizes with ATR Inhibitors in Cancer Cell Killing bioRxiv 2019 Jun 04 (WB, Human) WB Human
Chory EJ, Kirkland JG, Chang CY et al. Chemical Inhibitors of a Selective SWI/SNF Function Synergize with ATR Inhibition in Cancer Cell Killing ACS Chem. Biol. May 27 2020 [PMID: 32369697]
Shain AH, Giacomini CP, Matsukuma K, Karikari CA, Bashyam MD, Hidalgo M, Maitra A, Pollack JR. Convergent structural alterations define SWItch/Sucrose NonFermentable (SWI/SNF) chromatin remodeler as a central tumor suppressive complex in pancreatic cancer. Proc Natl Acad Sci U S A;109(5):E252-9. 2012 Jan 31. [PMID: 22233809]

Reviews for ARID1B Antibody (H00057492-M01) (0)

There are no reviews for ARID1B Antibody (H00057492-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARID1B Antibody (H00057492-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARID1B Products

Array H00057492-M01

Bioinformatics Tool for ARID1B Antibody (H00057492-M01)

Discover related pathways, diseases and genes to ARID1B Antibody (H00057492-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARID1B Antibody (H00057492-M01)

Discover more about diseases related to ARID1B Antibody (H00057492-M01).
 

Pathways for ARID1B Antibody (H00057492-M01)

View related products by pathway.

PTMs for ARID1B Antibody (H00057492-M01)

Learn more about PTMs related to ARID1B Antibody (H00057492-M01).

Blogs on ARID1B

There are no specific blogs for ARID1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARID1B Antibody (2D2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID1B
Entrez
Uniprot