ARHGEF3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARHGEF3 Antibody [NBP2-57422] - Staining of human cell line A-431 shows localization to cytosol.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGEF3 Recombinant Protein Antigen (NBP2-57422PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ARHGEF3 Antibody

  • DKFZP434F2429
  • Exchange factor found in platelets and leukemic and neuronal tissues
  • FLJ98126
  • MGC118905
  • Rho guanine nucleotide exchange factor (GEF) 3
  • rho guanine nucleotide exchange factor 3,59.8 kDA protein
  • RhoGEF protein
  • XPLNXPLN

Background

ARHGEF3, also known as Rho guanine nucleotide exchange factor 3, is a 526 amino acid protein that functions when extracellular interactions activate G coupled protein receptors through conversion of GTP into GDP, by increasing GTPase activity specifically Rho GTPases, which in turn has been shown to have a strong role in bone cells specifically with bone mineral density (BMD). Studies of ARHGEF3 are being done on the following diseases and disorders, hypochromic anemia, osteoporosis, neuronitis, leukemia, arthritis, and spasticity. This protein has interactions with RHOA, RHOB, SHC1, and CDC42 in the G-protein signaling pathways of both RhoA and RhoB, cell death signaling via NRAGE, NRIF and NADE, as well as the interferon pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83237
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF4737
Species: Hu
Applications: WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
AF3749
Species: Hu
Applications: IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
H00057449-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB7848
Species: Hu
Applications: IHC, WB
NBP3-13785
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
NBP2-57422
Species: Hu, Mu
Applications: ICC/IF

Publications for ARHGEF3 Antibody (NBP2-57422) (0)

There are no publications for ARHGEF3 Antibody (NBP2-57422).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF3 Antibody (NBP2-57422) (0)

There are no reviews for ARHGEF3 Antibody (NBP2-57422). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARHGEF3 Antibody (NBP2-57422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF3 Products

Bioinformatics Tool for ARHGEF3 Antibody (NBP2-57422)

Discover related pathways, diseases and genes to ARHGEF3 Antibody (NBP2-57422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF3 Antibody (NBP2-57422)

Discover more about diseases related to ARHGEF3 Antibody (NBP2-57422).
 

Pathways for ARHGEF3 Antibody (NBP2-57422)

View related products by pathway.

Research Areas for ARHGEF3 Antibody (NBP2-57422)

Find related products by research area.

Blogs on ARHGEF3

There are no specific blogs for ARHGEF3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF3