ARHGEF3 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK |
| Predicted Species |
Mouse (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ARHGEF3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ARHGEF3 Antibody - BSA Free
Background
ARHGEF3, also known as Rho guanine nucleotide exchange factor 3, is a 526 amino acid protein that functions when extracellular interactions activate G coupled protein receptors through conversion of GTP into GDP, by increasing GTPase activity specifically Rho GTPases, which in turn has been shown to have a strong role in bone cells specifically with bone mineral density (BMD). Studies of ARHGEF3 are being done on the following diseases and disorders, hypochromic anemia, osteoporosis, neuronitis, leukemia, arthritis, and spasticity. This protein has interactions with RHOA, RHOB, SHC1, and CDC42 in the G-protein signaling pathways of both RhoA and RhoB, cell death signaling via NRAGE, NRIF and NADE, as well as the interferon pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu, Mu
Applications: ICC/IF
Publications for ARHGEF3 Antibody (NBP2-57422) (0)
There are no publications for ARHGEF3 Antibody (NBP2-57422).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ARHGEF3 Antibody (NBP2-57422) (0)
There are no reviews for ARHGEF3 Antibody (NBP2-57422).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ARHGEF3 Antibody (NBP2-57422) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ARHGEF3 Products
Research Areas for ARHGEF3 Antibody (NBP2-57422)
Find related products by research area.
|
Blogs on ARHGEF3