ARHGEF3 Antibody

Immunocytochemistry/Immunofluorescence: ARHGEF3 Antibody [NBP2-57422] - Staining of human cell line A-431 shows localization to cytosol.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ARHGEF3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGEF3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARHGEF3 Recombinant Protein Antigen (NBP2-57422PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARHGEF3 Antibody

• DKFZP434F2429
• Exchange factor found in platelets and leukemic and neuronal tissues
• FLJ98126
• MGC118905
• Rho guanine nucleotide exchange factor (GEF) 3
• rho guanine nucleotide exchange factor 3,59.8 kDA protein
• RhoGEF protein
• XPLNXPLN

Background

ARHGEF3, also known as Rho guanine nucleotide exchange factor 3, is a 526 amino acid protein that functions when extracellular interactions activate G coupled protein receptors through conversion of GTP into GDP, by increasing GTPase activity specifically Rho GTPases, which in turn has been shown to have a strong role in bone cells specifically with bone mineral density (BMD). Studies of ARHGEF3 are being done on the following diseases and disorders, hypochromic anemia, osteoporosis, neuronitis, leukemia, arthritis, and spasticity. This protein has interactions with RHOA, RHOB, SHC1, and CDC42 in the G-protein signaling pathways of both RhoA and RhoB, cell death signaling via NRAGE, NRIF and NADE, as well as the interferon pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGEF3