Recombinant Human ARHGEF16 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ARHGEF16 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-421 of Human ARHGEF16 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ARHGEF16
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
75.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARHGEF16 GST (N-Term) Protein

  • EPHEXIN4
  • ephexin-4
  • GEF16
  • NBRRho guanine exchange factor (GEF) 16
  • Rho guanine nucleotide exchange factor (GEF) 16
  • rho guanine nucleotide exchange factor 16

Background

Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

236-EG
Species: Hu
Applications: BA
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00001617-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88832
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF3035
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
AF4414
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-87462
Species: Ca, Hu
Applications: IHC, IHC-P, WB
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ARHGEF16 Recombinant Protein (H00027237-P02) (0)

There are no publications for ARHGEF16 Recombinant Protein (H00027237-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF16 Recombinant Protein (H00027237-P02) (0)

There are no reviews for ARHGEF16 Recombinant Protein (H00027237-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGEF16 Recombinant Protein (H00027237-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGEF16 Products

Bioinformatics Tool for ARHGEF16 Recombinant Protein (H00027237-P02)

Discover related pathways, diseases and genes to ARHGEF16 Recombinant Protein (H00027237-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF16 Recombinant Protein (H00027237-P02)

Discover more about diseases related to ARHGEF16 Recombinant Protein (H00027237-P02).
 

Pathways for ARHGEF16 Recombinant Protein (H00027237-P02)

View related products by pathway.

PTMs for ARHGEF16 Recombinant Protein (H00027237-P02)

Learn more about PTMs related to ARHGEF16 Recombinant Protein (H00027237-P02).

Blogs on ARHGEF16

There are no specific blogs for ARHGEF16, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARHGEF16 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF16