Recombinant Human ARHGEF16 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ARHGEF16 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-421 of Human ARHGEF16 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ARHGEF16
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
75.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARHGEF16 Protein

  • EPHEXIN4
  • ephexin-4
  • GEF16
  • NBRRho guanine exchange factor (GEF) 16
  • Rho guanine nucleotide exchange factor (GEF) 16
  • rho guanine nucleotide exchange factor 16

Background

Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001617-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88832
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB3035
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF1396
Species: Hu
Applications: WB
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-03107
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
AF4414
Species: Hu
Applications: WB, IHC
H00000435-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr
NBP2-46617
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC

Publications for ARHGEF16 Recombinant Protein (H00027237-P02) (0)

There are no publications for ARHGEF16 Recombinant Protein (H00027237-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF16 Recombinant Protein (H00027237-P02) (0)

There are no reviews for ARHGEF16 Recombinant Protein (H00027237-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGEF16 Recombinant Protein (H00027237-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGEF16 Products

Bioinformatics Tool for ARHGEF16 Recombinant Protein (H00027237-P02)

Discover related pathways, diseases and genes to ARHGEF16 Recombinant Protein (H00027237-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF16 Recombinant Protein (H00027237-P02)

Discover more about diseases related to ARHGEF16 Recombinant Protein (H00027237-P02).
 

Pathways for ARHGEF16 Recombinant Protein (H00027237-P02)

View related products by pathway.

PTMs for ARHGEF16 Recombinant Protein (H00027237-P02)

Learn more about PTMs related to ARHGEF16 Recombinant Protein (H00027237-P02).

Blogs on ARHGEF16

There are no specific blogs for ARHGEF16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARHGEF16 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF16