ARHGEF11 Antibody

Images

 
Immunohistochemistry-Paraffin: ARHGEF11 Antibody [NBP1-83313] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGEF11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGGEGDNTQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGYKVVRKAEVAGSKVVPALP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ARHGEF11 Protein (NBP1-83313PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGEF11 Antibody

  • DKFZp667F1223
  • glutamate transporter EAAT4-associated protein 48
  • GTRAP48
  • KIAA0380rho guanine nucleotide exchange factor 11
  • PDZ-RHOGEF
  • Rho guanine exchange factor (GEF) 11
  • Rho guanine nucleotide exchange factor (GEF) 11
  • RhoA-specific guanine nucleotide exchange factor
  • RhoGEF glutamate transport modulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4737
Species: Hu
Applications: WB
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3749
Species: Hu
Applications: WB, IHC
NBP1-82843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-80886
Species: Hu
Applications: WB, IHC, IHC-P
H00005544-R02
Species: Hu
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP1-59632
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83313
Species: Hu
Applications: IHC, IHC-P

Publications for ARHGEF11 Antibody (NBP1-83313) (0)

There are no publications for ARHGEF11 Antibody (NBP1-83313).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF11 Antibody (NBP1-83313) (0)

There are no reviews for ARHGEF11 Antibody (NBP1-83313). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARHGEF11 Antibody (NBP1-83313) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF11 Products

Bioinformatics Tool for ARHGEF11 Antibody (NBP1-83313)

Discover related pathways, diseases and genes to ARHGEF11 Antibody (NBP1-83313). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF11 Antibody (NBP1-83313)

Discover more about diseases related to ARHGEF11 Antibody (NBP1-83313).
 

Pathways for ARHGEF11 Antibody (NBP1-83313)

View related products by pathway.

PTMs for ARHGEF11 Antibody (NBP1-83313)

Learn more about PTMs related to ARHGEF11 Antibody (NBP1-83313).

Blogs on ARHGEF11

There are no specific blogs for ARHGEF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF11