ARHGEF11 Antibody - BSA Free

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Staining of human cerebral cortex, colon, testis and tonsil using Anti-ARHGEF11 antibody NBP1-83312 (A) shows similar protein distribution across tissues to independent antibody NBP1-83314 (B).

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Analysis in control (vector only transfected HEK293T lysate) and ARHGEF11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGEF11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGEF11 Antibody - BSA Free (NBP1-83312) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPMPVHPPPPGPREPAQQGPTPSRVELDDSDVFHGEPEPEELPGGTGSQQRVQGKHQVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGEF11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ARHGEF11 Protein (NBP1-83312PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARHGEF11 Antibody - BSA Free

• DKFZp667F1223
• glutamate transporter EAAT4-associated protein 48
• GTRAP48
• KIAA0380rho guanine nucleotide exchange factor 11
• PDZ-RHOGEF
• Rho guanine exchange factor (GEF) 11
• Rho guanine nucleotide exchange factor (GEF) 11
• RhoA-specific guanine nucleotide exchange factor
• RhoGEF glutamate transport modulator

Background

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A similar protein in rat interacts with glutamate transporter EAAT4 and modulates its glutamate transport activity. Expression of the rat protein induces the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGEF11