ARHGAP8 Antibody - BSA Free

Western Blot: ARHGAP8 Antibody [NBP2-82657] - WB Suggested Anti-ARHGAP8 Antibody. Titration: 1.0 ug/ml. Positive Control: 293T Whole CellARHGAP8 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ARHGAP8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGAP8 Antibody - BSA Free (NBP2-82657) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ARHGAP8. Peptide sequence: PRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ARHGAP8 Antibody - BSA Free

• BCH Domain-Containing Cdc42GAP-Like Protein
• BNIP-2 And Cdc42GAP Homology Domain-Containing, Proline-Rich And
• BPGAP1
• Cdc42GAP-Like Protein Subtype-1
• PP610
• Rho GTPase Activating Protein 8
• Rho GTPase-Activating Protein 8
• Rho-Type GTPase-Activating Protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP8