ARHGAP20 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARHGAP20 Antibody [NBP2-56355] - Staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP20 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STTPFNLQEPFLMEQLPREMQCQFILKPSRLAAAQQLSDSGHKTFKRRRSIINWAFWRGSSTHLDNLPSSPTSPMPGQLFGISLP
Specificity
Specificity of human ARHGAP20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP20
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ARHGAP20 Antibody

  • KIAA1391Rho-type GTPase-activating protein 20
  • RA and RhoGAP domain containing protein
  • RARHOGAP
  • Rho GTPase activating protein 20
  • rho GTPase-activating protein 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56458
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
AF5599
Species: Mu
Applications: WB, IHC
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58173
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-65802
Species: Hu
NBP1-83693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83870
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58359
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
NBP1-83153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89732
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93587
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90852
Species: Hu
Applications: IHC, IHC-P

Publications for ARHGAP20 Antibody (NBP2-56355) (0)

There are no publications for ARHGAP20 Antibody (NBP2-56355).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP20 Antibody (NBP2-56355) (0)

There are no reviews for ARHGAP20 Antibody (NBP2-56355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARHGAP20 Antibody (NBP2-56355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARHGAP20 Products

Bioinformatics Tool for ARHGAP20 Antibody (NBP2-56355)

Discover related pathways, diseases and genes to ARHGAP20 Antibody (NBP2-56355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP20 Antibody (NBP2-56355)

Discover more about diseases related to ARHGAP20 Antibody (NBP2-56355).

Research Areas for ARHGAP20 Antibody (NBP2-56355)

Find related products by research area.

Blogs on ARHGAP20

There are no specific blogs for ARHGAP20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP20