FOXN2 Antibody

Images

 
Western Blot: FOXN2 Antibody [NBP1-83153] - Analysis in control (vector only transfected HEK293T lysate) and fOXN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: FOXN2 Antibody [NBP1-83153] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FOXN2 Antibody [NBP1-83153] - Staining of human adrenal gland shows nuclear positivity in cortical cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FOXN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHHPSAVRLQESDSLATSIDPKEDHNYSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FOXN2 Protein (NBP1-83153PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FOXN2 Antibody

  • forkhead box N2
  • Human T-cell leukemia virus enhancer factorHTLFforkhead box protein N2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-10820
Species: Hu
H00139628-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-23665
Species: Mu
Applications: WB
NBP2-47453
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-41158
Species: Hu, Mu
Applications: WB, ELISA
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5599
Species: Mu
Applications: WB, IHC
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-85801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56458
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB
NBP2-45712
Species: Hu
Applications: WB, IHC

Publications for FOXN2 Antibody (NBP1-83153) (0)

There are no publications for FOXN2 Antibody (NBP1-83153).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXN2 Antibody (NBP1-83153) (0)

There are no reviews for FOXN2 Antibody (NBP1-83153). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FOXN2 Antibody (NBP1-83153) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOXN2 Products

Bioinformatics Tool for FOXN2 Antibody (NBP1-83153)

Discover related pathways, diseases and genes to FOXN2 Antibody (NBP1-83153). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXN2 Antibody (NBP1-83153)

Discover more about diseases related to FOXN2 Antibody (NBP1-83153).
 

Pathways for FOXN2 Antibody (NBP1-83153)

View related products by pathway.

PTMs for FOXN2 Antibody (NBP1-83153)

Learn more about PTMs related to FOXN2 Antibody (NBP1-83153).

Blogs on FOXN2

There are no specific blogs for FOXN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXN2