ARHGAP19 Antibody

Western Blot: ARHGAP19 Antibody [NBP1-94047] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Immunocytochemistry/Immunofluorescence: ARHGAP19 Antibody [NBP1-94047] - Staining of human cell line U-2 OS shows localization to plasma membrane & vesicles.

Immunohistochemistry-Paraffin: ARHGAP19 Antibody [NBP1-94047] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ARHGAP19 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMF
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP19
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARHGAP19 Protein (NBP1-94047PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARHGAP19 Antibody

• DKFZp313K217
• MGC138804
• MGC138805
• MGC14258
• putative RhoGAP protein
• Rho GTPase activating protein 19
• rho GTPase-activating protein 19
• rho-type GTPase-activating protein 19

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP19
• Entrez:
  • 84986(Human)
• Uniprot:
  • Q14CB8(Human)