ARHGAP12 Antibody

Images

 
Western Blot: ARHGAP12 Antibody [NBP1-91678] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: ARHGAP12 Antibody [NBP1-91678] - Analysis in human cell line CAPAN-2.
Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ARHGAP12 Antibody [NBP1-91678] - Staining in human stomach and skeletal muscle tissues using anti-ARHGAP12 antibody. Corresponding ARHGAP12 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RGTQERTWKPPRWTRDASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYTNEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKWRHSTIVLDTNDKESPTASKPCFPENESSPSSP
Specificity
Specificity of human, mouse, rat ARHGAP12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Theoretical MW
96 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ARHGAP12 Protein (NBP1-91678PEP)
Publications
Read Publication using
NBP1-91678 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26465210).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP12 Antibody

  • Rho GTPase activating protein 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-89732
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-15452
Species: Hu, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57680
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000395-M01
Species: Hu
Applications: WB, ELISA

Publications for ARHGAP12 Antibody (NBP1-91678)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ARHGAP12 Antibody (NBP1-91678) (0)

There are no reviews for ARHGAP12 Antibody (NBP1-91678). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGAP12 Antibody (NBP1-91678) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ARHGAP12 Antibody (NBP1-91678)

Discover related pathways, diseases and genes to ARHGAP12 Antibody (NBP1-91678). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGAP12 Antibody (NBP1-91678)

Discover more about diseases related to ARHGAP12 Antibody (NBP1-91678).
 

Pathways for ARHGAP12 Antibody (NBP1-91678)

View related products by pathway.

Blogs on ARHGAP12

There are no specific blogs for ARHGAP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP12
Entrez
Uniprot