Novus Biologicals products are now on bio-techne.com

Arginyl tRNA synthetase Antibody

Images

 
Western Blot: Arginyl tRNA synthetase Antibody [NBP1-88032] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody [NBP1-88032] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Arginyl tRNA synthetase Antibody [NBP1-88032] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Arginyl tRNA synthetase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDGRKIV
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RARS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Arginyl tRNA synthetase Protein (NBP1-88032PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Arginyl tRNA synthetase Antibody

  • arginine tRNA ligase 1, cytoplasmic
  • Arginine--tRNA ligase
  • arginyl-tRNA synthetase
  • arginyl-tRNA synthetase, cytoplasmic
  • ArgRS
  • DALRD1
  • EC 6.1.1.19
  • MGC8641

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Arginyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-26326
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
MEP00B
Species: Mu
Applications: ELISA
AF4117
Species: Rt
Applications: IHC, WB
NBP3-07388
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
DTM100
Species: Hu
Applications: ELISA
MAB414
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
NBP2-36751
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
255-SC
Species: Hu
Applications: BA
NBP2-27206
Species: Bv, Ca, ChHa, Eq, Fe, Gp, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
MAB414
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for Arginyl tRNA synthetase Antibody (NBP1-88032) (0)

There are no publications for Arginyl tRNA synthetase Antibody (NBP1-88032).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arginyl tRNA synthetase Antibody (NBP1-88032) (0)

There are no reviews for Arginyl tRNA synthetase Antibody (NBP1-88032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Arginyl tRNA synthetase Antibody (NBP1-88032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arginyl tRNA synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RARS1
Entrez
Uniprot