Arginyl tRNA synthetase Antibody

Images

 
Western Blot: Arginyl tRNA synthetase Antibody [NBP1-88032] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody [NBP1-88032] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Arginyl tRNA synthetase Antibody [NBP1-88032] - Staining of human small intestine shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Arginyl tRNA synthetase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQELNKIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDGRKIV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Arginyl tRNA synthetase Protein (NBP1-88032PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Arginyl tRNA synthetase Antibody

  • arginine tRNA ligase 1, cytoplasmic
  • Arginine--tRNA ligase
  • arginyl-tRNA synthetase
  • arginyl-tRNA synthetase, cytoplasmic
  • ArgRS
  • DALRD1
  • EC 6.1.1.19
  • MGC8641

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-55256
Species: Hu
Applications: WB, IHC-P, IP
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-27080
Species: Hu, Mu, Rt, Po, Bv, ChHa, Eq, GP, Other, Pm
Applications: WB, Simple Western
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Arginyl tRNA synthetase Antibody (NBP1-88032) (0)

There are no publications for Arginyl tRNA synthetase Antibody (NBP1-88032).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arginyl tRNA synthetase Antibody (NBP1-88032) (0)

There are no reviews for Arginyl tRNA synthetase Antibody (NBP1-88032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Arginyl tRNA synthetase Antibody (NBP1-88032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Arginyl tRNA synthetase Products

Bioinformatics Tool for Arginyl tRNA synthetase Antibody (NBP1-88032)

Discover related pathways, diseases and genes to Arginyl tRNA synthetase Antibody (NBP1-88032). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arginyl tRNA synthetase Antibody (NBP1-88032)

Discover more about diseases related to Arginyl tRNA synthetase Antibody (NBP1-88032).
 

Pathways for Arginyl tRNA synthetase Antibody (NBP1-88032)

View related products by pathway.

PTMs for Arginyl tRNA synthetase Antibody (NBP1-88032)

Learn more about PTMs related to Arginyl tRNA synthetase Antibody (NBP1-88032).

Blogs on Arginyl tRNA synthetase

There are no specific blogs for Arginyl tRNA synthetase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arginyl tRNA synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RARS
Entrez
Uniprot