Arginine decarboxylase Antibody


Western Blot: Arginine decarboxylase Antibody [NBP1-70403] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.
Western Blot: Arginine decarboxylase Antibody [NBP1-70403] - Sample Type: Human and Rat Cerebral CortexPrimary Dilution: 1:3000.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Arginine decarboxylase Antibody Summary

Synthetic peptides corresponding to ADC (arginine decarboxylase) The peptide sequence was selected from the middle region of ADC)(50ug). Peptide sequence RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ADC and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Arginine decarboxylase Antibody

  • antizyme inhibitor 2
  • arginine decarboxylase
  • AZI2
  • KIAA1945
  • ODC antizyme inhibitor-2
  • ODC1L
  • ODC-p
  • ODC-paralogue
  • ornithine decarboxylase-like protein
  • ornithine decarboxylase-paralog


ADC decarboxylates L-arginine to agmatine. Truncated splice isoforms probably lack activity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Arginine decarboxylase Antibody (NBP1-70403) (0)

There are no publications for Arginine decarboxylase Antibody (NBP1-70403).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arginine decarboxylase Antibody (NBP1-70403) (0)

There are no reviews for Arginine decarboxylase Antibody (NBP1-70403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Arginine decarboxylase Antibody (NBP1-70403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Arginine decarboxylase Products

Arginine decarboxylase NBP1-70403

Bioinformatics Tool for Arginine decarboxylase Antibody (NBP1-70403)

Discover related pathways, diseases and genes to Arginine decarboxylase Antibody (NBP1-70403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arginine decarboxylase Antibody (NBP1-70403)

Discover more about diseases related to Arginine decarboxylase Antibody (NBP1-70403).

Pathways for Arginine decarboxylase Antibody (NBP1-70403)

View related products by pathway.

PTMs for Arginine decarboxylase Antibody (NBP1-70403)

Learn more about PTMs related to Arginine decarboxylase Antibody (NBP1-70403).

Blogs on Arginine decarboxylase

There are no specific blogs for Arginine decarboxylase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Arginine decarboxylase Antibody and receive a gift card or discount.


Gene Symbol ADC