Arginine decarboxylase Antibody

Images

 
Western Blot: Arginine decarboxylase Antibody [NBP1-70403] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.
Western Blot: Arginine decarboxylase Antibody [NBP1-70403] - Sample Type: Human and Rat Cerebral CortexPrimary Dilution: 1:3000.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Arginine decarboxylase Antibody Summary

Immunogen
Synthetic peptides corresponding to ADC (arginine decarboxylase) The peptide sequence was selected from the middle region of ADC)(50ug). Peptide sequence RHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ADC and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Arginine decarboxylase Antibody

  • antizyme inhibitor 2
  • ARGDC
  • arginine decarboxylase
  • AZI2
  • KIAA1945
  • ODC antizyme inhibitor-2
  • ODC1L
  • ODC-p
  • ODC-paralogue
  • ornithine decarboxylase-like protein
  • ornithine decarboxylase-paralog

Background

ADC decarboxylates L-arginine to agmatine. Truncated splice isoforms probably lack activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-70403
Species: Hu
Applications: WB

Publications for Arginine decarboxylase Antibody (NBP1-70403) (0)

There are no publications for Arginine decarboxylase Antibody (NBP1-70403).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arginine decarboxylase Antibody (NBP1-70403) (0)

There are no reviews for Arginine decarboxylase Antibody (NBP1-70403). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Arginine decarboxylase Antibody (NBP1-70403) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Arginine decarboxylase Products

Arginine decarboxylase NBP1-70403

Bioinformatics Tool for Arginine decarboxylase Antibody (NBP1-70403)

Discover related pathways, diseases and genes to Arginine decarboxylase Antibody (NBP1-70403). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arginine decarboxylase Antibody (NBP1-70403)

Discover more about diseases related to Arginine decarboxylase Antibody (NBP1-70403).
 

Pathways for Arginine decarboxylase Antibody (NBP1-70403)

View related products by pathway.

PTMs for Arginine decarboxylase Antibody (NBP1-70403)

Learn more about PTMs related to Arginine decarboxylase Antibody (NBP1-70403).

Blogs on Arginine decarboxylase

There are no specific blogs for Arginine decarboxylase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arginine decarboxylase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADC