ARFGEF1 Antibody (3E11) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse ARFGEF1 Antibody (3E11) - Azide and BSA Free (H00010565-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
ARFGEF1 (NP_006412.2, 311 a.a. ~ 411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSP |
| Specificity |
This product is specific for Human ARFGEF1 monoclonal antibody (M02), clone 3E11 [Gene ID: 10565]. |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ARFGEF1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
Mouse monoclonal antibody raised against a partial recombinant ARFGEF1. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ARFGEF1 Antibody (3E11) - Azide and BSA Free
Background
ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. The protein encoded by this gene is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP. It contains a Sec7 domain, which may be responsible for the guanine-nucleotide exchange activity and also the brefeldin A inhibition.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Publications for ARFGEF1 Antibody (H00010565-M02) (0)
There are no publications for ARFGEF1 Antibody (H00010565-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ARFGEF1 Antibody (H00010565-M02) (0)
There are no reviews for ARFGEF1 Antibody (H00010565-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ARFGEF1 Antibody (H00010565-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ARFGEF1 Products
Research Areas for ARFGEF1 Antibody (H00010565-M02)
Find related products by research area.
|
Blogs on ARFGEF1