ARF4 Antibody - BSA Free

Western Blot: ARF4 Antibody [NBP2-92502] - Analysis of extracts of various cell lines, using ARF4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: ARF4 Antibody - Azide and BSA Free [NBP2-92502] - Immunofluorescence analysis of C6 cells using ARF4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: ARF4 Antibody - Azide and BSA Free [NBP2-92502] - Immunofluorescence analysis of NIH/3T3 cells using ARF4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARF4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARF4 Antibody - BSA Free (NBP2-92502) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human ARF4 (NP_001651.1). MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 21 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARF4 Antibody - BSA Free

• ADP-ribosylation factor 4
• ARF2ADP-ribosylation factor 2

Background

The ARF4 gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins thatstimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and asactivators of phospholipase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

FAQs for ARF4 Antibody (NBP2-92502). (Showing 1 - 1 of 1 FAQ).

1. I was looking for antibodies against human ARF4 and ARF5 and I need to be able to distinguish between the two proteins. Do you have antibodies specific for each that don't cross react with the other protein?
   • The sequence similarity between ARF4 and ARF5 shows very high homology between the two proteins. We have not specifically tested for cross-reactivity between the antibodies, but I think it's very likely that they will cross react.

Bioinformatics

• Gene Symbol: ARF4