ARF5 Antibody (1B4)

Images

 
Western Blot: ARF5 Antibody (1B4) [H00000381-M01] - ARF5 monoclonal antibody (M01), clone 1B4 Analysis of ARF5 expression in A-431.
Immunocytochemistry/ Immunofluorescence: ARF5 Antibody (1B4) [H00000381-M01] - Analysis of monoclonal antibody to ARF5 on HeLa cell. Antibody concentration 15 ug/ml.
Western Blot: ARF5 Antibody (1B4) [H00000381-M01] - ARF5 monoclonal antibody (M01), clone 1B4. Analysis of ARF5 expression in HeLa.
Western Blot: ARF5 Antibody (1B4) [H00000381-M01] - ARF5 monoclonal antibody (M01), clone 1B4. Analysis of ARF5 expression in PC-12.
Western Blot: ARF5 Antibody (1B4) [H00000381-M01] - ARF5 monoclonal antibody (M01), clone 1B4. Analysis of ARF5 expression in Raw 264.7.
Western Blot: ARF5 Antibody (1B4) [H00000381-M01] - Analysis of ARF5 expression in transfected 293T cell line by ARF5 monoclonal antibody (M01), clone 1B4.Lane 1: ARF5 transfected lysate(20.5 KDa).Lane 2: ...read more
ELISA: ARF5 Antibody (1B4) [H00000381-M01] - Detection limit for recombinant GST tagged ARF5 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1B4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARF5 Antibody (1B4) Summary

Immunogen
ARF5 (AAH03043, 81 a.a. - 180 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Specificity
ARF5 - ADP-ribosylation factor 5
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARF5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Positive Control
ARF5 Lysate (NBP2-66258)
Publications
Read Publications using H00000381-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARF5 Antibody (1B4)

  • ADP-ribosylation factor 5

Background

ADP-ribosylation factor 5 (ARF5) is a member of the human ARF gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. The ARF5 gene spans approximately 3.2kb of genomic DNA and contains six exons and five introns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP2-26147
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP1-31004
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-32606
Species: Mu
Applications: IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16556
Species: Hu
Applications: WB
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00011247-T01
Species: Hu
NBP2-61784
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00000381-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for ARF5 Antibody (H00000381-M01)(11)


Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using H00000381-M01 Applications Species
Ignashkova TI, Gendarme M, Peschk K et al. Cell survival and protein secretion associated with Golgi integrity in response to Golgi stress-inducing agents. Traffic 2017 May 9 [PMID: 28485883]
Wesolowski J, Weber MM, Nawrotek A et al. Chlamydia Hijacks ARF GTPases To Coordinate Microtubule Posttranslational Modifications and Golgi Complex Positioning. MBio 2017 May 2 [PMID: 28465429]
Hanai A, Ohgi M, Yagi C et al. Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis. J Biochem. 2015 Sep 01 [PMID: 26330566]
Munzberg C, Hohn K, Krndija D et al. IGF-1 drives chromogranin A secretion via activation of Arf1 in human neuroendocrine tumour cells. J Cell Mol Med. 2015 Mar 08 [PMID: 25754106]
Reiling JH, Olive AJ, Sanyal S et al. A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens. Nat Cell Biol. 2013 Dec [PMID: 24185178]
Nakai W, Kondo Y, Saitoh A et al. ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus. Mol Biol Cell. 2013 Jun 19 [PMID: 23783033]
Takashima K, Saitoh A, Hirose S et al. GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis. Cell Struct Funct. 2012 Jun 01 [PMID: 22185782]
Kudelko M, Brault JB, Kwok K et al. Class II ADP-Ribosylation factors are required for efficient secretion of dengue viruses. J Biol Chem. 2011 Nov 21 [PMID: 22105072]
Puxeddu E, Uhart M, Li CC et al. Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 BIG2 effect on ARF1 activity. Proc Natl Acad Sci U S A;106(15):6158-63. 2009 Apr 14. [PMID: 19332778]
Klein S, Partisani M, Franco M et al. EFA6 facilitates the assembly of the tight junction by coordinating an Arf6-dependent independent pathway. J Biol Chem;283(44):30129-38. 2008 Oct 31. [PMID: 18779331]
Show All 11 Publications.

Reviews for ARF5 Antibody (H00000381-M01) (0)

There are no reviews for ARF5 Antibody (H00000381-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARF5 Antibody (H00000381-M01). (Showing 1 - 1 of 1 FAQs).

  1. I am looking for antibodies against human ARF4 and ARF5 and I need to be able to distinguish between the two proteins. Do you have antibodies specific for each protein that won't cross react with the other protein?
    • I checked the sequence similarity between ARF4 and ARF5, and there is very high homology between the two proteins. We have not specifically tested our antibodies for cross-reactivity between the two, but I think it's likely that they will.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ARF5 Antibody (H00000381-M01)

Discover related pathways, diseases and genes to ARF5 Antibody (H00000381-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARF5 Antibody (H00000381-M01)

Discover more about diseases related to ARF5 Antibody (H00000381-M01).
 

Pathways for ARF5 Antibody (H00000381-M01)

View related products by pathway.

PTMs for ARF5 Antibody (H00000381-M01)

Learn more about PTMs related to ARF5 Antibody (H00000381-M01).
 

Research Areas for ARF5 Antibody (H00000381-M01)

Find related products by research area.

Blogs on ARF5

There are no specific blogs for ARF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARF5 Antibody (1B4) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARF5
Entrez
OMIM
Uniprot