ARF4 Antibody - BSA Free

Western Blot: ARF4 Antibody [NBP1-79614] - Human NT-2 cells and Mouse WT brain, concentration 2ug/ml.

Western Blot: ARF4 Antibody [NBP1-79614] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ARF4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human Arf4The immunogen for this antibody is Arf4. Peptide sequence VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This antibody is predicted to react to human ARF1,3,4,5 (100% homology) and 6 (93%).
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ARF4 Antibody - BSA Free

• ADP-ribosylation factor 4
• ARF2ADP-ribosylation factor 2

Background

The ARF4 gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins thatstimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and asactivators of phospholipase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for ARF4 Antibody (NBP1-79614). (Showing 1 - 1 of 1 FAQ).

1. I was looking for antibodies against human ARF4 and ARF5 and I need to be able to distinguish between the two proteins. Do you have antibodies specific for each that don't cross react with the other protein?
   • The sequence similarity between ARF4 and ARF5 shows very high homology between the two proteins. We have not specifically tested for cross-reactivity between the antibodies, but I think it's very likely that they will cross react.

Bioinformatics

• Gene Symbol: ARF4
• Uniprot:
  • NP_031505(Mouse)