Orthogonal Strategies: Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Analysis in human salivary gland and liver tissues. Corresponding AQP5 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Aquaporin-5 Antibody [NBP2-39043] - Staining of human cell line SiHa shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human testis shows strong membranous positivity in subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human salivary gland shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human pancreas shows strong positivity in apical membrane in exocrine glandular cells.
Novus Biologicals Rabbit Aquaporin-5 Antibody - BSA Free (NBP2-39043) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Aquaporin-5 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AQP5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Aquaporin-5 Antibody - BSA Free
AQP5
AQP-5
Aquaporin 5
aquaporin-5
PPKB
Background
Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. At least ten isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP9. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7 and AQP9 are permeable to urea and glycerol. AQP2 is the only water channel that is activated by vasopressin to enhance water reabsorption in the kidney collecting duct. Aquaporins are involved in renal water absorption, generation of pulmonary secretions, lacrimation, and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. In the lung, the 27-kDa AQP5 is responsible for the majority of water transport across the apical membrane of type I alveolar epithelial cells. The gene encoding human AQP5 maps to chromosome 12q13.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Aquaporin-5 Antibody - BSA Free and receive a gift card or discount.