Aquaporin-5 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Analysis in human salivary gland and liver tissues. Corresponding AQP5 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Aquaporin-5 Antibody [NBP2-39043] - Staining of human cell line SiHa shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human testis shows strong membranous positivity in subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human salivary gland shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: Aquaporin-5 Antibody [NBP2-39043] - Staining of human pancreas shows strong positivity in apical membrane in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Aquaporin-5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AQP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aquaporin-5 Protein (NBP2-39043PEP)
Publications
Read Publication using
NBP2-39043 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Aquaporin-5 Antibody

  • AQP5
  • AQP-5
  • Aquaporin 5
  • aquaporin-5
  • PPKB

Background

Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. At least ten isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP9. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7 and AQP9 are permeable to urea and glycerol. AQP2 is the only water channel that is activated by vasopressin to enhance water reabsorption in the kidney collecting duct. Aquaporins are involved in renal water absorption, generation of pulmonary secretions, lacrimation, and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. In the lung, the 27-kDa AQP5 is responsible for the majority of water transport across the apical membrane of type I alveolar epithelial cells. The gene encoding human AQP5 maps to chromosome 12q13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aquaporin-5 Antibody (NBP2-39043)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Aquaporin-5 Antibody (NBP2-39043) (0)

There are no reviews for Aquaporin-5 Antibody (NBP2-39043). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Aquaporin-5 Antibody (NBP2-39043) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aquaporin-5 Products

Research Areas for Aquaporin-5 Antibody (NBP2-39043)

Find related products by research area.

Blogs on Aquaporin-5

There are no specific blogs for Aquaporin-5, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aquaporin-5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AQP5
Uniprot