Western Blot: Aquaporin-4 Antibody [NBP2-92886] - Western blot analysis of extracts of SKOV3 cells, using Aquaporin-4 antibody (NBP2-92886) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at ...read more
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP2-92886] - Immunohistochemistry of paraffin-embedded rat brain using Aquaporin-4 Rabbit pAb (NBP2-92886) at dilution of 1:100 (40x lens). Perform high pressure ...read more
Immunohistochemistry-Paraffin: Aquaporin-4 Antibody [NBP2-92886] - Immunohistochemistry of paraffin-embedded mouse kidney using Aquaporin-4 Rabbit pAb (NBP2-92886) at dilution of 1:100 (40x lens). Perform high pressure ...read more
Immunocytochemistry/ Immunofluorescence: Aquaporin-4 Antibody - Azide and BSA Free [NBP2-92886] - Immunofluorescence analysis of paraffin-embedded mouse brain using Aquaporin-4 Rabbit pAb at dilution of 1:50 (40x ...read more
Immunocytochemistry/ Immunofluorescence: Aquaporin-4 Antibody - Azide and BSA Free [NBP2-92886] - Immunofluorescence analysis of paraffin-embedded rat brain using Aquaporin-4 Rabbit pAb at dilution of 1:50 (40x lens). ...read more
Aquaporin 4 (AQP4) abundance is decreased in dystrophin-deficient diaphragms. (A) Ingenuity pathway analysis (IPA) demonstrated changes in various dystrophin-associated proteins, including a decrease in the level of ...read more
Novus Biologicals Rabbit Aquaporin-4 Antibody - Azide and BSA Free (NBP2-92886) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Aquaporin-4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 256-323 of human Aquaporin-4 (NP_001641.1). VEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AQP4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Alternate Names for Aquaporin-4 Antibody - Azide and BSA Free
AQP4
AQP-4
Aquaporin 4
MGC22454
MIWC
WCH4
Background
The Aquaporin-4 gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selectivechannels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Twoalternatively spliced tra
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Aquaporin-4 Antibody (NBP2-92886)(2)
We have publications tested in 2 confirmed species: Mouse, Rat.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Aquaporin-4 Antibody - Azide and BSA Free and receive a gift card or discount.