Home » APXL » APXL Antibodies » APXL Antibody

APXL Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: APXL Antibody [NBP2-13308] - Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.
Immunocytochemistry/ Immunofluorescence: APXL Antibody [NBP2-13308] - Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.
Immunohistochemistry-Paraffin: APXL Antibody [NBP2-13308] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

APXL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPLLIQDEDSTRIERVMDNNTTVKMVPIKIVHSESQPEKESRQSLACPAE PPALPHGLEKDQIKTLSTSEQFYS
Specificity
Specificity of human APXL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHROOM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
APXL Protein (NBP2-13308PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APXL Antibody

  • apical protein, Xenopus laevis-like
  • apical protein-like (Xenopus laevis)
  • Apical-like protein
  • APX homolog of Xenopus
  • APXLHSAPXL
  • DKFZp781J074
  • FLJ39277
  • Protein APXL
  • protein Shroom2
  • shroom family member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

APE Antibody
(13B8E5C2)
NB100-116
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: APE Antibody (13B8E5C2) [NB100-116] - APE1 antibody was tested in human breast cancer xenograft using DAB with hematoxylin counterstain.
(2 Reviews)
(79 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
CLCN4 Antibody
NBP1-84452
Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: IHC, IHC-P
CROP Antibody
NBP1-88053
Western Blot: CROP Antibody [NBP1-88053] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: CROP Antibody [NBP1-88053] - Staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: CROP Antibody [NBP1-88053] - Staining of human lymph node shows moderate nuclear positivity in germinal center and non-germinal center cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. Image from verified customer review.
(4 Reviews)
(1 Publication)
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
SHROOM3 Antibody
NBP2-14617
Immunohistochemistry-Paraffin: SHROOM3 Antibody [NBP2-14617] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: SHROOM3 Antibody [NBP2-14617] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: SHROOM3 Antibody [NBP2-14617] - Staining in human rectum and skeletal muscle tissues using anti-SHROOM3 antibody. Corresponding SHROOM3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
OA1 Antibody
NBP2-14066
Immunohistochemistry-Paraffin: OA1 Antibody [NBP2-14066] - Staining of human skin shows moderate to strong cytoplasmic positivity in melanocytes.
Immunohistochemistry-Paraffin: OA1 Antibody [NBP2-14066] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: OA1 Antibody [NBP2-14066] - Staining in human skin and skeletal muscle tissues. Corresponding GPR143 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
DCTN3 Antibody
NBP1-91823
Western Blot: DCTN3 Antibody [NBP1-91823] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-91823] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, IHC, IHC-P
DYNC1H1 Antibody
NBP1-84254
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
AMELX Protein
NBP2-22683
SDS-Page: Recombinant Human AMELX Protein [NBP2-22683]
Species: Hu
Myosin VIIa
Antibody
NBP1-84266
Immunocytochemistry/Immunofluorescence: Myosin VIIa Antibody [NBP1-84266] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Myosin VIIa Antibody [NBP1-84266] - Staining of human adrenal gland shows strong cytoplasmic and membranous positivity in cortical cells.
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Rab27a Antibody
(1G7)
H00005873-M02
Western Blot: Rab27a Antibody (1G7) [H00005873-M02] - RAB27A monoclonal antibody (M02), clone 1G7 Analysis of RAB27A expression in HL-60.
Immunohistochemistry-Paraffin: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of monoclonal antibody to RAB27A on formalin-fixed paraffin-embedded human lymphoma. Antibody concentration 3 ug/ml.
Western Blot: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of RAB27A over-expressed 293 cell line, cotransfected with RAB27A Validated Chimera RNAi ( Cat # H00005873-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB27A monoclonal antibody (M02), clone 1G7 (Cat # H00005873-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(12 Publications)
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
RPE Antibody
NBP1-56853
Western Blot: RPE Antibody [NBP1-56853] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/Immunofluorescence: RPE Antibody [NBP1-56853] - Antibody 0 Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm but only in connective tissue cells in the interlobular septum, very low tissue distribution Primary Antibody
Species: Hu
Applications: WB, ICC/IF, IHC
EIF5 Antibody
NBP1-86184
Western Blot: EIF5 Antibody [NBP1-86184] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: EIF5 Antibody [NBP1-86184] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: EIF5 Antibody [NBP1-86184] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Prohibitin 2
Antibody
NBP1-33463
Western Blot: Prohibitin 2 Antibody [NBP1-33463] - Sample (30 ug of whole cell lysate) A: H1299 B: Hela 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody [NBP1-33463] - Analysis of paraformaldehyde-fixed A431, using REA (NBP1-33463) antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP1-33463] - Paraffin-embedded mouse urinary bladder. Prohibitin 2 antibody diluted at 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
ACCN5 Antibody
NBP1-83258
Immunohistochemistry-Paraffin: ACCN5 Antibody [NBP1-83258] - Staining of human colon shows membranous positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P

Publications for APXL Antibody (NBP2-13308) (0)

There are no publications for APXL Antibody (NBP2-13308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APXL Antibody (NBP2-13308) (0)

There are no reviews for APXL Antibody (NBP2-13308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for APXL Antibody (NBP2-13308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APXL Products

Bioinformatics Tool for APXL Antibody (NBP2-13308)

Discover related pathways, diseases and genes to APXL Antibody (NBP2-13308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APXL Antibody (NBP2-13308)

Discover more about diseases related to APXL Antibody (NBP2-13308).
 

Pathways for APXL Antibody (NBP2-13308)

View related products by pathway.

Research Areas for APXL Antibody (NBP2-13308)

Find related products by research area.

Blogs on APXL

There are no specific blogs for APXL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APXL Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SHROOM2
Entrez
Uniprot