APXL Antibody


Immunocytochemistry/ Immunofluorescence: APXL Antibody [NBP2-13308] - Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.
Immunohistochemistry-Paraffin: APXL Antibody [NBP2-13308] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

APXL Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PPLLIQDEDSTRIERVMDNNTTVKMVPIKIVHSESQPEKESRQSLACPAE PPALPHGLEKDQIKTLSTSEQFYS
Specificity of human APXL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
APXL Protein (NBP2-13308PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for APXL Antibody

  • apical protein, Xenopus laevis-like
  • apical protein-like (Xenopus laevis)
  • Apical-like protein
  • APX homolog of Xenopus
  • DKFZp781J074
  • FLJ39277
  • Protein APXL
  • protein Shroom2
  • shroom family member 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for APXL Antibody (NBP2-13308) (0)

There are no publications for APXL Antibody (NBP2-13308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APXL Antibody (NBP2-13308) (0)

There are no reviews for APXL Antibody (NBP2-13308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for APXL Antibody (NBP2-13308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional APXL Products

Bioinformatics Tool for APXL Antibody (NBP2-13308)

Discover related pathways, diseases and genes to APXL Antibody (NBP2-13308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APXL Antibody (NBP2-13308)

Discover more about diseases related to APXL Antibody (NBP2-13308).

Pathways for APXL Antibody (NBP2-13308)

View related products by pathway.

Research Areas for APXL Antibody (NBP2-13308)

Find related products by research area.

Blogs on APXL

There are no specific blogs for APXL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our APXL Antibody and receive a gift card or discount.


Gene Symbol SHROOM2