Home » APXL » APXL Antibodies » APXL Antibody

APXL Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: APXL Antibody [NBP2-13308] - Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.
Immunocytochemistry/ Immunofluorescence: APXL Antibody [NBP2-13308] - Immunofluorescent staining of human cell line MCF7 shows localization to cell junctions.
Immunohistochemistry-Paraffin: APXL Antibody [NBP2-13308] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

APXL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPLLIQDEDSTRIERVMDNNTTVKMVPIKIVHSESQPEKESRQSLACPAE PPALPHGLEKDQIKTLSTSEQFYS
Specificity
Specificity of human APXL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SHROOM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
APXL Protein (NBP2-13308PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APXL Antibody

  • apical protein, Xenopus laevis-like
  • apical protein-like (Xenopus laevis)
  • Apical-like protein
  • APX homolog of Xenopus
  • APXLHSAPXL
  • DKFZp781J074
  • FLJ39277
  • Protein APXL
  • protein Shroom2
  • shroom family member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

APE Antibody
(13B8E5C2)
NB100-116
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL anti-APE-1 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Knockdown Validated: APE Antibody (13B8E5C2) [NB100-116] - Repression of p21 by APE1 in p53-null cells and effect of ectopic p53 in this repression. Representative Western analysis of p53, APE1, p21 and alpha-Tubulin levels in the same HCT116p53null cells. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0068467) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells stained NB100-116 (Green) detected with DyLight Fluor 488 conjugated anti-rabbit IgG secondary antibody. Nuclei are counterstained with Hoechst 33258 (Blue).
(3 Reviews)
(93 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
CLCN4 Antibody
NBP1-84452
Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: CLCN4 Antibody [NBP1-84452] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: IHC, IHC-P
CROP Antibody
NBP1-88053
Western Blot: CROP Antibody [NBP1-88053] - Analysis using Anti-LUC7L3 antibody NBP1-88053 (A) shows similar pattern to independent antibody NBP1-88052 (B).
Immunocytochemistry/Immunofluorescence: CROP Antibody [NBP1-88053] - Staining of human cell line U-2 OS shows localization to nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CROP Antibody [NBP1-88053] - Staining of human colon shows strong nuclear positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Tight Junction
Protein 1 Antibody
NBP1-85047
Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Rat epithelial cells stained positively with Tight Junction Protein 1. Primary antibody at 1:100. Secondary antibody: goat anti-rabbit-Alexa 488 conjugated at 1:500. ICC/IF image submitted by a verified customer review.
(5 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
SHROOM3 Antibody
NBP2-14617
Immunohistochemistry-Paraffin: SHROOM3 Antibody [NBP2-14617] - Staining in human rectum and skeletal muscle tissues using anti-SHROOM3 antibody. Corresponding SHROOM3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SHROOM3 Antibody [NBP2-14617] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: SHROOM3 Antibody [NBP2-14617] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
OA1 Antibody
NBP2-14066
Immunohistochemistry-Paraffin: OA1 Antibody [NBP2-14066] - Staining of human skin shows moderate to strong cytoplasmic positivity in melanocytes.
Immunohistochemistry-Paraffin: OA1 Antibody [NBP2-14066] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: OA1 Antibody [NBP2-14066] - Staining in human skin and skeletal muscle tissues. Corresponding GPR143 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
DCTN3 Antibody
NBP2-98673
Western Blot: DCTN3 Antibody [NBP2-98673] - Anti-DCTN3 rabbit polyclonal antibody at 1:500 dilution. Lane A: 293T Whole Cell Lysate Lane B: HeLa Whole Cell Lysate Lane C: U-251 MG Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 21 kDa. Observed band size: 21 kDa
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP2-98673] - Immunochemical staining of human DCTN3 in human pancreas with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.
Immunoprecipitation: DCTN3 Antibody [NBP2-98673] - DCTN3 was immunoprecipitated using: Lane A: 0.5 mg HeLa Whole Cell Lysate 4 ul anti-DCTN3 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein A/G. Primary antibody: Anti-DCTN3 rabbit polyclonal antibody, at 1:100 dilution. Secondary antibody: Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 21 kDa. Observed band size: 21 kDa
Species: Hu
Applications: WB, IHC, IHC-P, IP
DYNC1H1 Antibody
NBP1-84254
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AMELX Antibody
(3B5)
H00000265-M03
Western Blot: AMELX Antibody (3B5) [H00000265-M03] - Analysis of AMELX expression in A-431 (Cat # L015V1).
ELISA: AMELX Antibody (3B5) [H00000265-M03] - Detection limit for recombinant GST tagged AMELX is 0.03 ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Myosin VIIa
Antibody
NB120-3481
Western Blot: Myosin VIIa Antibody [NB120-3481] - Analysis of mouse testes tissue extract.
(2 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Gp, Pm
Applications: WB, IHC
Rab27a Antibody
(1G7)
H00005873-M02
Western Blot: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of RAB27A expression in transfected 293T cell line by RAB27A monoclonal antibody (M02), clone 1G7.Lane 1: RAB27A transfected lysate(24.9 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of monoclonal antibody to RAB27A on formalin-fixed paraffin-embedded human lymphoma. Antibody concentration 3 ug/ml.
Western Blot: Rab27a Antibody (1G7) [H00005873-M02] - Analysis of RAB27A over-expressed 293 cell line, cotransfected with RAB27A Validated Chimera RNAi ( Cat # H00005873-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB27A monoclonal antibody (M02), clone 1G7 (Cat # H00005873-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
(12 Publications)
Species: Hu, Mu, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
RPE Antibody
NBP1-56853
Western Blot: RPE Antibody [NBP1-56853] - Human Muscle lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/Immunofluorescence: RPE Antibody [NBP1-56853] - Antibody 0 Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver Observed Staining: Cytoplasm but only in connective tissue cells in the interlobular septum, very low tissue distribution Primary Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
EIF5 Antibody
NBP1-86184
Western Blot: EIF5 Antibody [NBP1-86184] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: EIF5 Antibody [NBP1-86184] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: EIF5 Antibody [NBP1-86184] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Prohibitin 2
Antibody
NBP2-13754
Western Blot: Prohibitin 2 Antibody [NBP2-13754] - Analysis in human cell line BEWO.
Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody [NBP2-13754] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Prohibitin 2 Antibody [NBP2-13754] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
ACCN5 GST (N-Term) Pr ...
H00051802-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu

Publications for APXL Antibody (NBP2-13308) (0)

There are no publications for APXL Antibody (NBP2-13308).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APXL Antibody (NBP2-13308) (0)

There are no reviews for APXL Antibody (NBP2-13308). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for APXL Antibody (NBP2-13308) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional APXL Products

Array NBP2-13308

Bioinformatics Tool for APXL Antibody (NBP2-13308)

Discover related pathways, diseases and genes to APXL Antibody (NBP2-13308). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APXL Antibody (NBP2-13308)

Discover more about diseases related to APXL Antibody (NBP2-13308).
 

Pathways for APXL Antibody (NBP2-13308)

View related products by pathway.

Research Areas for APXL Antibody (NBP2-13308)

Find related products by research area.

Blogs on APXL

There are no specific blogs for APXL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APXL Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SHROOM2
Entrez
Uniprot