OA1 Antibody

Images

 
Immunohistochemistry: OA1 Antibody [NBP2-14066] - Staining of human skin shows moderate cytoplasmic positivity in melanocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSD EALSMLSEGSDASTIEIHTASESCNKNEGDPALPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPR143
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
OA1 Protein (NBP2-14066PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OA1 Antibody

  • G protein-coupled receptor 143
  • G-protein coupled receptor 143
  • NYS6
  • OA1Ocular albinism type 1 protein
  • ocular albinism 1 (Nettleship-Falls)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
NBP1-59786
Species: Hu
Applications: WB
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60052
Species: Hu
Applications: WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP2-14066
Species: Hu
Applications: IHC, IHC-P

Publications for OA1 Antibody (NBP2-14066) (0)

There are no publications for OA1 Antibody (NBP2-14066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OA1 Antibody (NBP2-14066) (0)

There are no reviews for OA1 Antibody (NBP2-14066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for OA1 Antibody (NBP2-14066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional OA1 Products

Bioinformatics Tool for OA1 Antibody (NBP2-14066)

Discover related pathways, diseases and genes to OA1 Antibody (NBP2-14066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OA1 Antibody (NBP2-14066)

Discover more about diseases related to OA1 Antibody (NBP2-14066).
 

Pathways for OA1 Antibody (NBP2-14066)

View related products by pathway.

PTMs for OA1 Antibody (NBP2-14066)

Learn more about PTMs related to OA1 Antibody (NBP2-14066).
 

Research Areas for OA1 Antibody (NBP2-14066)

Find related products by research area.

Blogs on OA1

There are no specific blogs for OA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPR143