APRT Antibody - Azide and BSA Free

Western Blot: APRT Antibody [H00000353-B01P] - Analysis of APRT expression in transfected 293T cell line by APRT polyclonal antibody. Lane 1: APRT transfected lysate(19.8 KDa). Lane 2: Non-transfected lysate.

Western Blot: APRT Antibody [H00000353-B01P] - APRT MaxPab polyclonal antibody. Western Blot analysis of APRT expression in human liver.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

APRT Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: APRT (NP_000476.1, 1 a.a. - 180 a.a.) full-length human protein. MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
• Specificity: Reacts with adenine phosphoribosyltransferase.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: APRT
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for APRT Antibody - Azide and BSA Free

• adenine phosphoribosyltransferase
• AMP diphosphorylase
• AMP pyrophosphorylase
• AMP
• DKFZp686D13177
• EC 2.4.2.7
• MGC125856
• MGC125857
• MGC129961
• transphosphoribosidase

Background

Adenine phosphoribosyltransferase belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for APRT Antibody (H00000353-B01P)(1)

Publication using H00000353-B01P

• Herencia C, Martinez-Moreno JM, Herrera C, Corrales F, Santiago-Mora R, Espejo I, Barco M, Almaden Y, de la Mata M, Rodriguez-Ariza A, Munoz-Castaneda JR. Nuclear Translocation of ?-Catenin during Mesenchymal Stem Cells Differentiation into Hepatocytes Is Associated with a Tumoral Phenotype. PLoS One;7(4). 2012-01-01 [PMID: 22506042] (WB, Human)

Bioinformatics

• Gene Symbol: APRT
• Entrez:
  • 353(Human)
• Uniprot:
  • NP_000476.1(Human)