APPL Recombinant Protein Antigen

Images

 
There are currently no images for APPL Recombinant Protein Antigen (NBP2-76565PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

APPL Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APPL.

Source: E. coli

Amino Acid Sequence: KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APPL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76565.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for APPL Recombinant Protein Antigen

  • Adapter protein containing PH domain, PTB domain and leucine zipper motif 1
  • adaptor protein containing pH domain, PTB domain and leucine zipper motif 1
  • adaptor protein, phosphotyrosine interaction, PH domain and leucine zippercontaining 1
  • AKT2 interactor
  • APPL
  • APPL1
  • APPLdip13-alpha
  • DCC-interacting protein 13-alpha
  • DIP 13 alpha
  • DIP13A
  • DIP13alpha
  • Dip13-alpha
  • KIAA1428
  • signaling adaptor protein DIP13alpha

Background

APPL is encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DRP300
Species: Hu
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-89029
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00055198-B01P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB120-13253
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC,  IHC-P, IP, WB
NBP2-67631
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-28641
Species: Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, PA, Simple Western, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
AF3129
Species: Hu
Applications: IHC, IP, Simple Western, WB
NBP1-80973
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-48615
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-36489
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-30914
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IM, WB
NBP2-76565PEP
Species: Hu
Applications: AC

Publications for APPL Recombinant Protein Antigen (NBP2-76565PEP) (0)

There are no publications for APPL Recombinant Protein Antigen (NBP2-76565PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APPL Recombinant Protein Antigen (NBP2-76565PEP) (0)

There are no reviews for APPL Recombinant Protein Antigen (NBP2-76565PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for APPL Recombinant Protein Antigen (NBP2-76565PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APPL Products

Research Areas for APPL Recombinant Protein Antigen (NBP2-76565PEP)

Find related products by research area.

Blogs on APPL

There are no specific blogs for APPL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our APPL Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APPL1