Apolipoprotein H/ApoH Antibody

Images

 
Western Blot: Apolipoprotein H/ApoH Antibody [H00000350-B01P] - Analysis of APOH expression in transfected 293T cell line by APOH polyclonal antibody. Lane 1: APOH transfected lysate(37.95 KDa). Lane 2: Non-transfected ...read more
Western Blot: Apolipoprotein H/ApoH Antibody [H00000350-B01P] - Analysis of APOH expression in human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Apolipoprotein H/ApoH Antibody Summary

Immunogen
APOH (AAH26283.1, 1 a.a. - 345 a.a.) full-length human protein. MISPVLILFSSFLCHVAIAGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Specificity
APOH - apolipoprotein H (beta-2-glycoprotein I),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
APOH
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apolipoprotein H/ApoH Antibody

  • Activated protein C-binding protein
  • Anticardiolipin cofactor
  • APC inhibitor
  • APOH
  • apo-H
  • apolipoprotein H (beta-2-glycoprotein I)
  • Apolipoprotein H
  • B2G1
  • B2GP1
  • B2GPI
  • Beta
  • beta(2)GPI
  • beta-2-glycoprotein 1
  • Beta-2-glycoprotein I
  • BG

Background

Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7565
Species: Hu, Mu, Rt
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu

Publications for Apolipoprotein H/ApoH Antibody (H00000350-B01P) (0)

There are no publications for Apolipoprotein H/ApoH Antibody (H00000350-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein H/ApoH Antibody (H00000350-B01P) (0)

There are no reviews for Apolipoprotein H/ApoH Antibody (H00000350-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein H/ApoH Antibody (H00000350-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein H/ApoH Products

Bioinformatics Tool for Apolipoprotein H/ApoH Antibody (H00000350-B01P)

Discover related pathways, diseases and genes to Apolipoprotein H/ApoH Antibody (H00000350-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein H/ApoH Antibody (H00000350-B01P)

Discover more about diseases related to Apolipoprotein H/ApoH Antibody (H00000350-B01P).
 

Pathways for Apolipoprotein H/ApoH Antibody (H00000350-B01P)

View related products by pathway.

PTMs for Apolipoprotein H/ApoH Antibody (H00000350-B01P)

Learn more about PTMs related to Apolipoprotein H/ApoH Antibody (H00000350-B01P).
 

Research Areas for Apolipoprotein H/ApoH Antibody (H00000350-B01P)

Find related products by research area.

Blogs on Apolipoprotein H/ApoH

There are no specific blogs for Apolipoprotein H/ApoH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein H/ApoH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOH
Entrez
Uniprot