Apolipoprotein B/ApoB Antibody (2T5X0)

Western Blot: Apolipoprotein B/ApoB Antibody (2T5X0) [NBP3-16350] - Western blot analysis of extracts of various cell lines, using Apolipoprotein B/ApoB Rabbit mAb (NBP3-16350) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

• Reactivity: Mu, Rt
• Applications: WB
• Clone: 2T5X0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Apolipoprotein B/ApoB Antibody (2T5X0) Summary

• Description: Novus Biologicals Rabbit Apolipoprotein B/ApoB Antibody (2T5X0) (NBP3-16350) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Apolipoprotein B/ApoB (P04114). RKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: APOB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Apolipoprotein B/ApoB Antibody (2T5X0)

• Apo B-100
• APOB
• ApoB-100
• ApoB-48
• apolipoprotein B (including Ag(x) antigen)
• Apolipoprotein B
• apolipoprotein B-100
• apolipoprotein B48
• FLDB
• LDLCQ4
• mutant Apo B 100

Background

Apolipoprotein B (apo B) in human plasma is a major protein of low density lipoproteins (LDL). The molecular mass is 260 kDa. Apo B binds to specific receptors on cell membranes and is involved in removal of LDL and very low density lipoprotein (VLDL) cholesterol from circulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APOB