APOL6 Antibody

Images

 
Western Blot: APOL6 Antibody [NBP1-89031] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-39
Immunocytochemistry/ Immunofluorescence: APOL6 Antibody [NBP1-89031] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: APOL6 Antibody [NBP1-89031] - Staining of human cerebral cortex shows strong nucleolar and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APOL6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKLRALADDIDKTHKKFTKAN
Specificity
Specificity of human APOL6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOL6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APOL6 Antibody

  • apolipoprotein L, 6
  • apolipoprotein L6
  • Apolipoprotein L-VI
  • APOLVI
  • APOL-VI
  • DKFZp667M075
  • FLJ38562
  • FLJ90164
  • MGC57495

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89033
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-88640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for APOL6 Antibody (NBP1-89031) (0)

There are no publications for APOL6 Antibody (NBP1-89031).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOL6 Antibody (NBP1-89031) (0)

There are no reviews for APOL6 Antibody (NBP1-89031). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for APOL6 Antibody (NBP1-89031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional APOL6 Products

Array NBP1-89031

Bioinformatics Tool for APOL6 Antibody (NBP1-89031)

Discover related pathways, diseases and genes to APOL6 Antibody (NBP1-89031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOL6 Antibody (NBP1-89031)

Discover more about diseases related to APOL6 Antibody (NBP1-89031).
 

Pathways for APOL6 Antibody (NBP1-89031)

View related products by pathway.

Blogs on APOL6

There are no specific blogs for APOL6, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOL6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOL6
Novus 100% Guarantee