APH1A Antibody - Azide and BSA Free

Western Blot: APH1A Antibody [NBP2-92623] - Analysis of extracts of various cell lines, using APH1A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: APH1A Antibody [NBP2-92623] - Analysis of L929 cells using APH1A . Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

APH1A Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human APH1A (NP_001071096.1). TSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APH1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for APH1A Antibody - Azide and BSA Free

• 6530402N02Rik
• anterior pharynx defective 1 homolog A (C. elegans)
• APH-1
• APH1A
• APH-1A
• aph-1alpha
• CGI-78
• gamma-secretase subunit APH-1A
• Presenilin-stabilization factor
• PSF

Background

Anterior Pharynx Defective 1 (APH1a) is an integral transmembrane protein forming a component of the gamma-secretase complex, a complex composed of a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PEN2. The gamma-secretase complex is an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: APH1A